BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1104 (476 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81120-5|CAB03347.1| 183|Caenorhabditis elegans Hypothetical pr... 29 1.7 AC087079-14|AAM81101.1| 392|Caenorhabditis elegans Nuclear pore... 27 7.0 AC087079-13|AAK27866.1| 787|Caenorhabditis elegans Nuclear pore... 27 7.0 >Z81120-5|CAB03347.1| 183|Caenorhabditis elegans Hypothetical protein T12D8.7 protein. Length = 183 Score = 29.1 bits (62), Expect = 1.7 Identities = 17/57 (29%), Positives = 28/57 (49%) Frame = -3 Query: 402 TAETGRAVIPTRADSQEVIYRSVIDNNQTLMGDFSHQFGLRILK*QSSQLKQRKFIF 232 TA V+ T A +E I + D NQ + H +GL++ + QL Q+ F++ Sbjct: 80 TAADMLGVLTTNAPDREKILQLANDKNQQPLPQIRHNYGLKLPNDRFCQL-QQNFVY 135 >AC087079-14|AAM81101.1| 392|Caenorhabditis elegans Nuclear pore complex protein protein13, isoform b protein. Length = 392 Score = 27.1 bits (57), Expect = 7.0 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 451 ANPPFQTEKTGHSNLLHGRNRQGGDTYPCGLTRG 350 ANP FQT + G N R G + CG+ G Sbjct: 21 ANPIFQTNRVGQENSQQFTVRNGVEQELCGILGG 54 >AC087079-13|AAK27866.1| 787|Caenorhabditis elegans Nuclear pore complex protein protein13, isoform a protein. Length = 787 Score = 27.1 bits (57), Expect = 7.0 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 451 ANPPFQTEKTGHSNLLHGRNRQGGDTYPCGLTRG 350 ANP FQT + G N R G + CG+ G Sbjct: 21 ANPIFQTNRVGQENSQQFTVRNGVEQELCGILGG 54 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,793,706 Number of Sequences: 27780 Number of extensions: 221890 Number of successful extensions: 520 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 491 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 520 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 871571276 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -