BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1104 (476 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g48980.1 68418.m06060 kelch repeat-containing F-box family pr... 29 1.2 At4g28130.1 68417.m04033 diacylglycerol kinase accessory domain-... 28 2.8 At2g20900.3 68415.m02465 diacylglycerol kinase, putative contain... 28 2.8 At2g20900.2 68415.m02464 diacylglycerol kinase, putative contain... 28 2.8 At2g20900.1 68415.m02463 diacylglycerol kinase, putative contain... 28 2.8 >At5g48980.1 68418.m06060 kelch repeat-containing F-box family protein contains F-box domain Pfam:PF00646 and Kelch motif Pfam:PF01344 Length = 399 Score = 29.5 bits (63), Expect = 1.2 Identities = 16/41 (39%), Positives = 20/41 (48%) Frame = -2 Query: 364 GLTRGHL*ICHRQQPNINGRFFTSIRSPDFEVTVFTIKAKK 242 G T L +C R N R+FT R P+ +T T K KK Sbjct: 79 GKTENFLYVCLRFPDEANPRWFTLYRKPNQTLTDHTTKKKK 119 >At4g28130.1 68417.m04033 diacylglycerol kinase accessory domain-containing protein similar to diacylglycerol kinase [Lycopersicon esculentum] GI:10798892; contains Pfam profile PF00609: Diacylglycerol kinase accessory domain (presumed) Length = 466 Score = 28.3 bits (60), Expect = 2.8 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = -1 Query: 464 PPPVGQPPLSNGKNRPFQLASRQKQAG 384 PPP+ PL G N PF +K G Sbjct: 138 PPPIATVPLGTGNNLPFAFGWGKKNPG 164 >At2g20900.3 68415.m02465 diacylglycerol kinase, putative contains INTERPRO domain, IPR001206, DAG-kinase catalytic domain Length = 491 Score = 28.3 bits (60), Expect = 2.8 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = -1 Query: 464 PPPVGQPPLSNGKNRPFQLASRQKQAG 384 PPP+ PL G N PF +K G Sbjct: 131 PPPIATVPLGTGNNLPFAFGWGKKNPG 157 >At2g20900.2 68415.m02464 diacylglycerol kinase, putative contains INTERPRO domain, IPR001206, DAG-kinase catalytic domain Length = 491 Score = 28.3 bits (60), Expect = 2.8 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = -1 Query: 464 PPPVGQPPLSNGKNRPFQLASRQKQAG 384 PPP+ PL G N PF +K G Sbjct: 131 PPPIATVPLGTGNNLPFAFGWGKKNPG 157 >At2g20900.1 68415.m02463 diacylglycerol kinase, putative contains INTERPRO domain, IPR001206, DAG-kinase catalytic domain Length = 509 Score = 28.3 bits (60), Expect = 2.8 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = -1 Query: 464 PPPVGQPPLSNGKNRPFQLASRQKQAG 384 PPP+ PL G N PF +K G Sbjct: 131 PPPIATVPLGTGNNLPFAFGWGKKNPG 157 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,026,092 Number of Sequences: 28952 Number of extensions: 199912 Number of successful extensions: 451 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 435 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 451 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 821630280 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -