Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--1103
         (493 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At2g19240.1 68415.m02246 RabGAP/TBC domain-containing protein lo...    31   0.42 

>At2g19240.1 68415.m02246 RabGAP/TBC domain-containing protein low
           similarity to SP|Q08484 GTPase-activating protein GYP1
           {Saccharomyces cerevisiae}; contains Pfam profile
           PF00566: TBC domain
          Length = 840

 Score = 31.1 bits (67), Expect = 0.42
 Identities = 16/38 (42%), Positives = 21/38 (55%)
 Frame = +3

Query: 78  KGFRFF*CTRWLIV*GVTVFLIK*LNSSVTSTRQLISC 191
           + FR F C R  +V G+TV +I  L SS+ ST     C
Sbjct: 368 QNFRIFDCPRGTLVLGMTVSMILYLRSSLLSTENATCC 405


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 8,795,689
Number of Sequences: 28952
Number of extensions: 149564
Number of successful extensions: 157
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 150
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 157
length of database: 12,070,560
effective HSP length: 76
effective length of database: 9,870,208
effective search space used: 858708096
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)