BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1102 (508 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_08_0038 - 14336633-14336864,14336970-14337187,14337302-14339020 29 2.1 05_05_0318 + 24052022-24053858,24053935-24054132,24054363-24055351 28 5.0 10_08_0041 - 14374684-14377339,14377371-14378233 27 6.5 >10_08_0038 - 14336633-14336864,14336970-14337187,14337302-14339020 Length = 722 Score = 29.1 bits (62), Expect = 2.1 Identities = 15/49 (30%), Positives = 25/49 (51%) Frame = -3 Query: 269 MRFFLSSHNTRYHKELLIFICSVNHDTTKFDVCVTVPQFPYKPCGHLSH 123 + F + ++ +YH E + F+ S HD T+ P+F Y+ G L H Sbjct: 421 INFDFNVNSPKYHGESIHFLSSQGHDLTQHSKRGVTPEFVYE--GLLRH 467 >05_05_0318 + 24052022-24053858,24053935-24054132,24054363-24055351 Length = 1007 Score = 27.9 bits (59), Expect = 5.0 Identities = 14/42 (33%), Positives = 19/42 (45%) Frame = -2 Query: 429 SPVNPNFT*VGLEFVHSFKQ*KKAPFSVRAIERFFCSSHNPD 304 S +PN +G E VH K P + RA+ C+ N D Sbjct: 351 SSAHPNLEMIGKEIVHKL---KGLPLAARALGSLLCAKDNED 389 >10_08_0041 - 14374684-14377339,14377371-14378233 Length = 1172 Score = 27.5 bits (58), Expect = 6.5 Identities = 14/49 (28%), Positives = 25/49 (51%) Frame = -3 Query: 269 MRFFLSSHNTRYHKELLIFICSVNHDTTKFDVCVTVPQFPYKPCGHLSH 123 + F + ++ +YH + + F+ S HD T+ P+F Y+ G L H Sbjct: 738 INFDFNVNSPKYHGKSIDFLSSQGHDLTQHSKRGVAPEFVYE--GLLRH 784 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,561,141 Number of Sequences: 37544 Number of extensions: 236362 Number of successful extensions: 359 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 353 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 359 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1083123860 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -