BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1102 (508 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 24 0.79 DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex det... 22 4.2 DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex det... 22 4.2 EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 21 9.7 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 24.2 bits (50), Expect = 0.79 Identities = 11/38 (28%), Positives = 17/38 (44%) Frame = -3 Query: 248 HNTRYHKELLIFICSVNHDTTKFDVCVTVPQFPYKPCG 135 HN Y+K+L I ++ V + FP +P G Sbjct: 324 HNNNYNKKLYYNIINIEQIPVPVPVPIHCGNFPPRPMG 361 >DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.8 bits (44), Expect = 4.2 Identities = 11/38 (28%), Positives = 17/38 (44%) Frame = -3 Query: 248 HNTRYHKELLIFICSVNHDTTKFDVCVTVPQFPYKPCG 135 +N Y+K+L I ++ V V FP +P G Sbjct: 104 NNNNYNKKLYYNIINIEQIPVPVPVPVYCGNFPPRPMG 141 >DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.8 bits (44), Expect = 4.2 Identities = 11/38 (28%), Positives = 17/38 (44%) Frame = -3 Query: 248 HNTRYHKELLIFICSVNHDTTKFDVCVTVPQFPYKPCG 135 +N Y+K+L I ++ V V FP +P G Sbjct: 104 NNNNYNKKLYYNIINIEQIPVPVPVPVYCGNFPPRPMG 141 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 20.6 bits (41), Expect = 9.7 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +3 Query: 297 IINQDYEKNRKSAQWHALRKVL 362 ++NQ + + +S HA RKVL Sbjct: 258 MVNQKFSELIQSKPQHARRKVL 279 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 137,570 Number of Sequences: 438 Number of extensions: 2967 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 13986774 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -