BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1102 (508 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g62040.1 68418.m07787 brother of FT and TFL1 protein (BFT) id... 29 1.8 At2g20320.1 68415.m02373 DENN (AEX-3) domain-containing protein ... 29 2.4 At3g52780.1 68416.m05815 purple acid phosphatase (PAP20) identic... 27 7.3 At5g03840.1 68418.m00354 terminal flower 1 protein (TFL1) identi... 27 9.6 At3g10430.1 68416.m01251 F-box family protein contains F-box dom... 27 9.6 >At5g62040.1 68418.m07787 brother of FT and TFL1 protein (BFT) identical to SP|Q9FIT4 BROTHER of FT and TFL1 protein {Arabidopsis thaliana}; contains Pfam profile PF01161: Phosphatidylethanolamine-binding protein Length = 177 Score = 29.1 bits (62), Expect = 1.8 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = -1 Query: 451 HFLCP*IVSGKPQLHIGGPRVRSFF 377 H L P ++ KP++ IGG +RSFF Sbjct: 41 HELAPSLLLSKPRVEIGGQDLRSFF 65 >At2g20320.1 68415.m02373 DENN (AEX-3) domain-containing protein contains Pfam domain PF02141: DENN (AEX-3) domain Length = 976 Score = 28.7 bits (61), Expect = 2.4 Identities = 16/53 (30%), Positives = 26/53 (49%) Frame = -3 Query: 284 FKFKTMRFFLSSHNTRYHKELLIFICSVNHDTTKFDVCVTVPQFPYKPCGHLS 126 F FK +S+ + + + + IC V D T + VC+ V + +P G LS Sbjct: 446 FSFKCQ---ISTSHVKSNTRQIKIICQVADDATLYGVCLHVSEIVQRPPGVLS 495 >At3g52780.1 68416.m05815 purple acid phosphatase (PAP20) identical to purple acid phosphatase GI:20257491 from [Arabidopsis thaliana] Length = 427 Score = 27.1 bits (57), Expect = 7.3 Identities = 15/37 (40%), Positives = 20/37 (54%), Gaps = 2/37 (5%) Frame = +2 Query: 398 PTYVKLGFTGDY--LRTKEMGPPPQISLF*KKKRGGG 502 P Y+ +G G+ L TK P P+ISLF + G G Sbjct: 350 PVYINIGDGGNLEGLATKYRDPNPEISLFREASFGHG 386 >At5g03840.1 68418.m00354 terminal flower 1 protein (TFL1) identical go SP|P93003 TERMINAL FLOWER 1 protein {Arabidopsis thaliana}; contains Pfam profile PF01161: Phosphatidylethanolamine-binding protein Length = 177 Score = 26.6 bits (56), Expect = 9.6 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = -1 Query: 451 HFLCP*IVSGKPQLHIGGPRVRSFF 377 H L P VS KP++ I G +RSFF Sbjct: 44 HELFPSSVSSKPRVEIHGGDLRSFF 68 >At3g10430.1 68416.m01251 F-box family protein contains F-box domain Pfam:PF00646 Length = 370 Score = 26.6 bits (56), Expect = 9.6 Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = -1 Query: 112 HCDVTNERTDEVTLIHRYLLLNV-IIIIFRSIGV 14 H VTN+ +DEV RY + + I +FRSI + Sbjct: 262 HVSVTNKLSDEVVSFSRYFSVTLPDIPLFRSIDI 295 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,096,969 Number of Sequences: 28952 Number of extensions: 192446 Number of successful extensions: 298 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 296 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 298 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 908059136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -