BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1099 (515 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY278448-1|AAP37005.1| 147|Anopheles gambiae microsomal glutath... 23 6.1 AY943928-1|AAX49501.1| 753|Anopheles gambiae laccase-2 isoform ... 23 8.1 >AY278448-1|AAP37005.1| 147|Anopheles gambiae microsomal glutathione transferase GSTMIC3protein. Length = 147 Score = 23.0 bits (47), Expect = 6.1 Identities = 9/30 (30%), Positives = 17/30 (56%) Frame = -2 Query: 343 SDIINVLIFIVITFFYMKSQMGMLIDDTLF 254 +D+ N+L + +I F YM + + + LF Sbjct: 72 NDMENILPYFIIGFLYMFTNPSVTVATNLF 101 >AY943928-1|AAX49501.1| 753|Anopheles gambiae laccase-2 isoform A protein. Length = 753 Score = 22.6 bits (46), Expect = 8.1 Identities = 7/22 (31%), Positives = 12/22 (54%) Frame = +2 Query: 392 IKIRFFILVPGSLYSPKTFGNF 457 + RF++ P L+ P T+ F Sbjct: 536 LPFRFYLYRPEELFQPNTYNRF 557 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 385,488 Number of Sequences: 2352 Number of extensions: 5218 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 46937349 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -