BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1099 (515 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z68117-5|CAA92177.2| 303|Caenorhabditis elegans Hypothetical pr... 29 1.5 Z68131-1|CAA92217.1| 467|Caenorhabditis elegans Hypothetical pr... 27 6.0 >Z68117-5|CAA92177.2| 303|Caenorhabditis elegans Hypothetical protein F45E6.1 protein. Length = 303 Score = 29.5 bits (63), Expect = 1.5 Identities = 17/42 (40%), Positives = 22/42 (52%) Frame = -2 Query: 280 GMLIDDTLFYSNIFRAKFQNRLFLTI*LIGTKSMKALQLRTN 155 G LI T+FY IF + Q + LTI +G K M +L N Sbjct: 102 GSLIVATIFYYLIFISSMQRFMLLTIEKLGRKLMTGARLTFN 143 >Z68131-1|CAA92217.1| 467|Caenorhabditis elegans Hypothetical protein B0395.2 protein. Length = 467 Score = 27.5 bits (58), Expect = 6.0 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = -3 Query: 414 KIKNRIFII*SKLLTSLFENFHFKVI 337 + K + F++ LLTS F N H K+I Sbjct: 34 EFKEKTFVVRESLLTSEFRNGHMKII 59 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,840,815 Number of Sequences: 27780 Number of extensions: 145850 Number of successful extensions: 246 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 242 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 246 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 996506972 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -