BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1094 (471 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_13884| Best HMM Match : LRR_1 (HMM E-Value=6.3e-06) 33 0.16 SB_13096| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_37665| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.5 SB_45368| Best HMM Match : fn2 (HMM E-Value=3.1e-32) 29 1.9 SB_49900| Best HMM Match : GETHR (HMM E-Value=5e-18) 29 2.6 SB_33751| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.8 >SB_13884| Best HMM Match : LRR_1 (HMM E-Value=6.3e-06) Length = 575 Score = 32.7 bits (71), Expect = 0.16 Identities = 13/28 (46%), Positives = 22/28 (78%) Frame = +3 Query: 18 NSTIGYIAPNAFHGVHDLYAVNLSNNNL 101 N++I IAP+AF G+ +L ++NL +NN+ Sbjct: 137 NNSISAIAPHAFKGLDNLQSLNLRHNNI 164 >SB_13096| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1465 Score = 29.9 bits (64), Expect = 1.1 Identities = 15/51 (29%), Positives = 24/51 (47%) Frame = +2 Query: 260 ITANTFKNMPGLMYLNVAGNNLSDMDPDTFXXXXXXXXXXXRNNHIKSLPR 412 I TF+N+ GL L + NN++++D F N + +LPR Sbjct: 203 IEPGTFRNLRGLEILYLNNNNITELDQRLFTRTPSLKLLFVSFNSLATLPR 253 >SB_37665| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 270 Score = 29.5 bits (63), Expect = 1.5 Identities = 14/27 (51%), Positives = 18/27 (66%) Frame = -2 Query: 434 FPRENVRCVGAI*CDCCGDLTLRDRVI 354 F RE +R + I C CC +TLRDRV+ Sbjct: 194 FRREYMRYLSYI-CGCCDAVTLRDRVL 219 >SB_45368| Best HMM Match : fn2 (HMM E-Value=3.1e-32) Length = 1206 Score = 29.1 bits (62), Expect = 1.9 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +3 Query: 12 IVNSTIGYIAPNAFHGVHDLYAVNLSNNNLKSLHPETF 125 I N+ I I F V DL +NL NN + ++ +TF Sbjct: 1120 IGNNLIKDIPSGVFANVRDLQVLNLHNNEITTIDEDTF 1157 >SB_49900| Best HMM Match : GETHR (HMM E-Value=5e-18) Length = 1044 Score = 28.7 bits (61), Expect = 2.6 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +3 Query: 15 VNSTIGYIAPNAFHGVHDLYAVNLSNNNLKSLHPETFA 128 V + I YI AF DL +NL+NN ++ + FA Sbjct: 4 VRANIQYIDDFAFEKARDLVYINLANNPIEVIEEGAFA 41 >SB_33751| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 27.1 bits (57), Expect = 7.8 Identities = 8/21 (38%), Positives = 15/21 (71%) Frame = -3 Query: 310 NIQVHQTRHIFESICRDVLML 248 ++QVH +RH+ ++C D+ L Sbjct: 2 DVQVHLSRHLLRTVCTDITNL 22 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,599,608 Number of Sequences: 59808 Number of extensions: 233915 Number of successful extensions: 529 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 476 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 525 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 982083920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -