Bombyx BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--1092
         (488 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

03_05_0213 - 22037268-22039496                                         27   8.1  

>03_05_0213 - 22037268-22039496
          Length = 742

 Score = 27.1 bits (57), Expect = 8.1
 Identities = 22/63 (34%), Positives = 30/63 (47%)
 Frame = +1

Query: 271 EEVFENLDRDALISRVKRKELVEYFNTVIDGCAKGQNKSDDVTCKKFLVFCQRIKKSNPP 450
           EEVF+ +D    +  + R  +   FNT+IDG  K   K DD     F +  Q I +   P
Sbjct: 481 EEVFDQMD----LQGISRNAIT--FNTLIDGLCK-DKKIDDA----FELINQMISEGLQP 529

Query: 451 NRI 459
           N I
Sbjct: 530 NNI 532


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,597,039
Number of Sequences: 37544
Number of extensions: 200458
Number of successful extensions: 398
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 389
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 398
length of database: 14,793,348
effective HSP length: 77
effective length of database: 11,902,460
effective search space used: 1011709100
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)