BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1092 (488 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_2038| Best HMM Match : rve (HMM E-Value=0.0076) 28 3.6 SB_6255| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 >SB_2038| Best HMM Match : rve (HMM E-Value=0.0076) Length = 656 Score = 28.3 bits (60), Expect = 3.6 Identities = 18/58 (31%), Positives = 31/58 (53%) Frame = +1 Query: 235 SAANGRIMELYFEEVFENLDRDALISRVKRKELVEYFNTVIDGCAKGQNKSDDVTCKK 408 S A ++ E EE+ ++LD + + KEL +Y N + + A+ NK D+V K+ Sbjct: 567 SKAKEKLNEEMIEEI-DHLDNEIDNLDLVNKELSKYINNLHNNSAQTANKIDEVGKKQ 623 >SB_6255| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 526 Score = 27.1 bits (57), Expect = 8.3 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = +1 Query: 154 THLKFGIIKI*CFTKVCFF*MDNENYKSAANGR 252 T L+FGI +I C CF+ +EN ++ N + Sbjct: 157 TFLEFGIRRIMCHQSECFYDFRHENAENWENNK 189 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,977,256 Number of Sequences: 59808 Number of extensions: 258997 Number of successful extensions: 525 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 512 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 525 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1038380485 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -