BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1092 (488 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor pr... 23 1.3 DQ855482-1|ABH88169.1| 116|Apis mellifera chemosensory protein ... 22 4.0 AJ973399-1|CAJ01446.1| 116|Apis mellifera hypothetical protein ... 22 4.0 DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chlor... 21 5.3 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 21 7.0 AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 21 9.3 >DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor protein. Length = 459 Score = 23.4 bits (48), Expect = 1.3 Identities = 19/86 (22%), Positives = 39/86 (45%), Gaps = 2/86 (2%) Frame = -3 Query: 414 QKLFACYIV*LILS--FSTAVDNSIEIFNKFLPFDSTDQSITI*IFENLFKIQFHDASIC 241 + +F +++ LI + F+T VD + + + +S + +I + EN+ + + S Sbjct: 152 RSIFGAWLIALIFAMPFATYVDINYVEYPQNSKRNSEESAICAMLKENMPEFPLYQLSCI 211 Query: 240 SRFIIFVVHLKKTYFRETLNFNDPKL 163 F+I +V + Y R L L Sbjct: 212 LFFLIPMVFIAVLYIRIGLRIQSDSL 237 >DQ855482-1|ABH88169.1| 116|Apis mellifera chemosensory protein 1 protein. Length = 116 Score = 21.8 bits (44), Expect = 4.0 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +2 Query: 413 WFSVSELKKVTHQTEFRGKKK 475 WF+ +E +K H E KKK Sbjct: 92 WFTTNEPEKWNHFVEIMIKKK 112 >AJ973399-1|CAJ01446.1| 116|Apis mellifera hypothetical protein protein. Length = 116 Score = 21.8 bits (44), Expect = 4.0 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +2 Query: 413 WFSVSELKKVTHQTEFRGKKK 475 WF+ +E +K H E KKK Sbjct: 92 WFTTNEPEKWNHFVEIMIKKK 112 >DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chloride channel protein. Length = 383 Score = 21.4 bits (43), Expect = 5.3 Identities = 10/34 (29%), Positives = 19/34 (55%) Frame = -3 Query: 285 FENLFKIQFHDASICSRFIIFVVHLKKTYFRETL 184 F+N K+ FH+ SI + + +++ H K + L Sbjct: 94 FKNAKKVTFHEMSIPNHY-LWLYHDKTLLYMSKL 126 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 21.0 bits (42), Expect = 7.0 Identities = 8/27 (29%), Positives = 15/27 (55%) Frame = +1 Query: 217 DNENYKSAANGRIMELYFEEVFENLDR 297 +N NYK N +LY++ N+++ Sbjct: 325 NNNNYKYNYNNYNKKLYYKNYIINIEQ 351 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 20.6 bits (41), Expect = 9.3 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = +2 Query: 335 LNISILLSTAVLKDRISQTM 394 L ++ILLS V + +++TM Sbjct: 265 LGVTILLSLTVFLNMVAETM 284 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 136,517 Number of Sequences: 438 Number of extensions: 2843 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 13421061 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -