BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1091 (508 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_06_0585 - 34912159-34912224,34912634-34913247,34913350-349137... 101 3e-22 05_01_0047 - 323097-323162,323287-323900,324233-324626,324718-32... 101 4e-22 01_07_0285 - 42476767-42476832,42476990-42477603,42477821-424782... 101 4e-22 12_01_0409 - 3230853-3230918,3231372-3231994,3232454-3232847,323... 100 6e-22 03_05_0926 + 28871800-28871859,28871943-28872336,28872586-288731... 100 6e-22 10_08_0597 + 19089616-19089675,19089789-19090182,19090451-190910... 98 4e-21 05_04_0450 - 21356877-21356942,21357482-21358095,21358173-213585... 98 4e-21 01_06_1455 + 37504175-37504231,37504357-37504750,37504865-375054... 98 4e-21 11_01_0403 + 3059650-3059709,3059807-3060200,3060275-3060930,306... 85 2e-17 03_06_0192 + 32230953-32231030,32231130-32231485,32232250-322324... 57 9e-09 08_01_0254 + 2078380-2078392,2078487-2078578,2079579-2079698,207... 51 5e-07 12_02_1282 + 27528159-27529148,27529549-27529614 50 1e-06 02_04_0473 + 23197294-23197340,23197443-23197680,23197792-231980... 45 4e-05 08_01_0194 - 1603702-1603782,1603970-1604062,1604203-1604328,160... 42 4e-04 01_01_1170 - 9318332-9318461,9318551-9318613,9318694-9318744,931... 38 0.004 04_04_1515 + 34117383-34117732,34117833-34117918,34118227-341182... 34 0.075 06_03_0876 - 25593744-25594046,25594747-25594902,25594986-255950... 30 0.93 03_02_0519 + 9066918-9068261 30 1.2 09_04_0117 + 14813472-14814113,14814194-14814404,14814552-148148... 29 2.1 04_03_0998 - 21555696-21556080,21556177-21556254,21556333-215564... 29 2.1 08_02_0441 - 17196352-17196536,17196780-17196906,17198018-171981... 28 5.0 03_05_0644 + 26376544-26376929,26377013-26377193,26377314-26379017 27 6.5 01_01_0292 - 2387653-2387711,2388061-2388684,2388814-2389104,238... 27 6.5 07_03_0463 - 18449908-18450171,18450718-18450810,18451170-184512... 27 8.7 >03_06_0585 - 34912159-34912224,34912634-34913247,34913350-34913734, 34913824-34913883 Length = 374 Score = 101 bits (242), Expect = 3e-22 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -2 Query: 411 IIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 271 ++APPERKYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 328 VVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 374 >05_01_0047 - 323097-323162,323287-323900,324233-324626,324718-324777 Length = 377 Score = 101 bits (241), Expect = 4e-22 Identities = 43/47 (91%), Positives = 46/47 (97%) Frame = -2 Query: 411 IIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 271 ++APPERKYSVWIGGSILASLSTFQQMWISK EYDESGP+IVHRKCF Sbjct: 331 VVAPPERKYSVWIGGSILASLSTFQQMWISKDEYDESGPAIVHRKCF 377 >01_07_0285 - 42476767-42476832,42476990-42477603,42477821-42478214, 42478301-42478360 Length = 377 Score = 101 bits (241), Expect = 4e-22 Identities = 43/47 (91%), Positives = 46/47 (97%) Frame = -2 Query: 411 IIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 271 ++APPERKYSVWIGGSILASLSTFQQMWISK EYDESGP+IVHRKCF Sbjct: 331 VVAPPERKYSVWIGGSILASLSTFQQMWISKDEYDESGPAIVHRKCF 377 >12_01_0409 - 3230853-3230918,3231372-3231994,3232454-3232847, 3233000-3233059 Length = 380 Score = 100 bits (240), Expect = 6e-22 Identities = 43/47 (91%), Positives = 46/47 (97%) Frame = -2 Query: 411 IIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 271 ++APPERKYSVWIGGSILASLSTFQQMWISK EYDESGP+IVHRKCF Sbjct: 334 VVAPPERKYSVWIGGSILASLSTFQQMWISKAEYDESGPAIVHRKCF 380 >03_05_0926 + 28871800-28871859,28871943-28872336,28872586-28873199, 28873281-28873346 Length = 377 Score = 100 bits (240), Expect = 6e-22 Identities = 43/47 (91%), Positives = 46/47 (97%) Frame = -2 Query: 411 IIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 271 ++APPERKYSVWIGGSILASLSTFQQMWI+K EYDESGPSIVHRKCF Sbjct: 331 VVAPPERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 377 >10_08_0597 + 19089616-19089675,19089789-19090182,19090451-19091064, 19091160-19091225 Length = 377 Score = 97.9 bits (233), Expect = 4e-21 Identities = 41/47 (87%), Positives = 46/47 (97%) Frame = -2 Query: 411 IIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 271 ++APPERKYSVWIGGSILASLSTFQQMWIS+ EY+ESGP+IVHRKCF Sbjct: 331 VVAPPERKYSVWIGGSILASLSTFQQMWISRAEYEESGPAIVHRKCF 377 >05_04_0450 - 21356877-21356942,21357482-21358095,21358173-21358566, 21358648-21358704 Length = 376 Score = 97.9 bits (233), Expect = 4e-21 Identities = 43/47 (91%), Positives = 44/47 (93%) Frame = -2 Query: 411 IIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 271 +IAPPERKYSVWIGGSILASLSTFQQMWISK EYDESGP IVH KCF Sbjct: 330 VIAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPGIVHMKCF 376 >01_06_1455 + 37504175-37504231,37504357-37504750,37504865-37505478, 37506021-37506086 Length = 376 Score = 97.9 bits (233), Expect = 4e-21 Identities = 42/47 (89%), Positives = 44/47 (93%) Frame = -2 Query: 411 IIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 271 ++APPERKYSVWIGGSILASLSTFQQMWISK EYDESGP IVH KCF Sbjct: 330 VVAPPERKYSVWIGGSILASLSTFQQMWISKAEYDESGPGIVHMKCF 376 >11_01_0403 + 3059650-3059709,3059807-3060200,3060275-3060930, 3060979-3061044 Length = 391 Score = 85.4 bits (202), Expect = 2e-17 Identities = 43/61 (70%), Positives = 46/61 (75%), Gaps = 14/61 (22%) Frame = -2 Query: 411 IIAPPERKYSVWIGGSILASLSTFQ--------------QMWISKQEYDESGPSIVHRKC 274 ++APPERKYSVWIGGSILASLSTFQ QMWISK EYDESGP+IVHRKC Sbjct: 331 VVAPPERKYSVWIGGSILASLSTFQQVNLTPTLYEVARMQMWISKGEYDESGPAIVHRKC 390 Query: 273 F 271 F Sbjct: 391 F 391 >03_06_0192 + 32230953-32231030,32231130-32231485,32232250-32232425, 32233857-32234038,32234260-32234443,32235192-32235259, 32235343-32235495 Length = 398 Score = 56.8 bits (131), Expect = 9e-09 Identities = 25/53 (47%), Positives = 36/53 (67%), Gaps = 6/53 (11%) Frame = -2 Query: 411 IIAPPE------RKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 271 ++ PPE +YS W+GG+ILA + Q ++K +YDE+GPSIVH+KCF Sbjct: 346 LVKPPEYMPENLARYSAWLGGAILAKVVFPQNQHVTKGDYDETGPSIVHKKCF 398 >08_01_0254 + 2078380-2078392,2078487-2078578,2079579-2079698, 2079924-2080097,2080184-2080257,2080847-2080927, 2081306-2081366,2081437-2081486,2082278-2082332, 2082599-2082676,2082757-2082810,2083703-2083756, 2083846-2083906,2084229-2084280,2085118-2085184, 2085393-2085452,2085546-2085608,2085752-2085814, 2086337-2086401,2086620-2086688,2086742-2086847 Length = 503 Score = 51.2 bits (117), Expect = 5e-07 Identities = 21/28 (75%), Positives = 25/28 (89%) Frame = -2 Query: 396 ERKYSVWIGGSILASLSTFQQMWISKQE 313 ER++SVWIGGSILASL +FQQMW SK + Sbjct: 442 ERRFSVWIGGSILASLGSFQQMWFSKAD 469 >12_02_1282 + 27528159-27529148,27529549-27529614 Length = 351 Score = 49.6 bits (113), Expect = 1e-06 Identities = 22/30 (73%), Positives = 24/30 (80%) Frame = -2 Query: 360 LASLSTFQQMWISKQEYDESGPSIVHRKCF 271 LA S +MWI+K EYDESGPSIVHRKCF Sbjct: 322 LAPSSMKIKMWIAKAEYDESGPSIVHRKCF 351 >02_04_0473 + 23197294-23197340,23197443-23197680,23197792-23198016, 23198616-23198762,23198827-23198961,23199415-23199507, 23199925-23200044,23200303-23200413,23200486-23200611, 23200731-23200829,23201024-23201104 Length = 473 Score = 44.8 bits (101), Expect = 4e-05 Identities = 18/41 (43%), Positives = 29/41 (70%) Frame = -2 Query: 411 IIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSI 289 +++ P ++Y+VW GGS+LAS + F + +K EY+E G SI Sbjct: 422 VVSHPIQRYAVWFGGSVLASTAEFYEACHTKAEYEEYGASI 462 >08_01_0194 - 1603702-1603782,1603970-1604062,1604203-1604328, 1604403-1604513,1604989-1605108,1605665-1605757, 1606024-1606157,1606503-1606530,1606821-1607075, 1607167-1607401,1608147-1608193 Length = 440 Score = 41.5 bits (93), Expect = 4e-04 Identities = 17/41 (41%), Positives = 26/41 (63%) Frame = -2 Query: 411 IIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSI 289 ++A P + Y+ W GGS+ AS F + +K+EY+E G SI Sbjct: 389 VVAHPIQSYAAWFGGSVAASNPEFYESCHTKEEYEEHGASI 429 >01_01_1170 - 9318332-9318461,9318551-9318613,9318694-9318744, 9318837-9318921,9319005-9319068,9319139-9319340, 9319808-9320502 Length = 429 Score = 38.3 bits (85), Expect = 0.004 Identities = 19/47 (40%), Positives = 25/47 (53%) Frame = -2 Query: 411 IIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 271 IIA + W GGS+LA F+ M I+K EY+E G R+ F Sbjct: 382 IIAQEDPILGAWRGGSLLAHRPDFESMCITKSEYEEMGSMRCRRRFF 428 >04_04_1515 + 34117383-34117732,34117833-34117918,34118227-34118297, 34118457-34118524,34118692-34118753,34119010-34119107, 34119545-34119626,34119935-34120077,34120233-34120381, 34120461-34120594,34120714-34120832,34120926-34121014, 34121398-34121515 Length = 522 Score = 33.9 bits (74), Expect = 0.075 Identities = 16/48 (33%), Positives = 29/48 (60%), Gaps = 5/48 (10%) Frame = -2 Query: 411 IIAPPERKYSVWIGGSILASLSTFQQMW-ISKQEYDE----SGPSIVH 283 +I PP S W G +++++STF + W I K+++ + +GPS V+ Sbjct: 435 VIPPPFGTDSAWFGAKMISNVSTFTEAWCIKKKQFRQKTRRNGPSFVN 482 >06_03_0876 - 25593744-25594046,25594747-25594902,25594986-25595095, 25595429-25595520,25595613-25595657,25595775-25595920, 25596027-25596114,25596251-25596281,25596388-25596413, 25596617-25596939 Length = 439 Score = 30.3 bits (65), Expect = 0.93 Identities = 22/62 (35%), Positives = 29/62 (46%), Gaps = 2/62 (3%) Frame = -3 Query: 476 NFQPRGFLRP--PQFSDNEDF*KESLLLQRGSTPYGSVDRSSPPSLPSNRCGSRNRSTTS 303 N+ P RP P D+ED +S P G V +S PS PS+ S RS+T+ Sbjct: 374 NWAPPYAARPRLPGAEDDED--DDSAAAASSGFPMGQVATASSPSRPSSSSCSSRRSSTA 431 Query: 302 LA 297 A Sbjct: 432 AA 433 >03_02_0519 + 9066918-9068261 Length = 447 Score = 29.9 bits (64), Expect = 1.2 Identities = 16/36 (44%), Positives = 22/36 (61%), Gaps = 2/36 (5%) Frame = +3 Query: 201 NGDYKPELSSRPRAAGGSTRGAF--RSTSCVQWRGQ 302 NG Y P L+ A+G S+ GA ST+C +WRG+ Sbjct: 84 NGSYAPPLTPAFNASGSSSYGAVPCPSTAC-EWRGR 118 >09_04_0117 + 14813472-14814113,14814194-14814404,14814552-14814846, 14815059-14815448,14815528-14815605,14815692-14815926 Length = 616 Score = 29.1 bits (62), Expect = 2.1 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = -1 Query: 415 RNHCSSREEVLRMDRWIDPRLPLYLPTDVDLETGVRRV 302 +N C+ + +L MDR + P + + DVD+ T V R+ Sbjct: 537 KNKCNMEDILLEMDRVLRPEGAVIMRDDVDILTKVNRL 574 >04_03_0998 - 21555696-21556080,21556177-21556254,21556333-21556424, 21556524-21556620,21557113-21557141,21557620-21557781, 21557981-21558061,21558156-21558314,21558394-21558510, 21558598-21558666,21558753-21558831,21560884-21561050, 21561109-21561229,21561522-21561649,21562293-21562361, 21562408-21562539,21562619-21562991,21563274-21563398, 21563500-21563655,21563785-21564198,21564634-21564691, 21566522-21566648,21568047-21568305,21569005-21569104, 21569231-21569317,21569454-21569692,21569914-21569999, 21570409-21570532,21571111-21574332 Length = 2444 Score = 29.1 bits (62), Expect = 2.1 Identities = 17/50 (34%), Positives = 24/50 (48%), Gaps = 1/50 (2%) Frame = +2 Query: 236 AGCWRQ-HARCV*KHFLCTMEGPDSSYSCFEIHICWKVEREARIDPPIHT 382 A C RQ HA+C+ LC EG ++ C + +R+ PIHT Sbjct: 1110 AQCERQYHAKCIYGKLLCNEEGGPCAWFCGRRCQQIYMNLRSRVGIPIHT 1159 >08_02_0441 - 17196352-17196536,17196780-17196906,17198018-17198101, 17198282-17198348,17198575-17198633,17199211-17199336, 17199406-17199474,17199545-17199653,17199692-17199760, 17199876-17199979,17200518-17200567,17200696-17200774, 17200867-17200938,17201083-17201217,17201311-17201421, 17202088-17202129 Length = 495 Score = 27.9 bits (59), Expect = 5.0 Identities = 9/18 (50%), Positives = 15/18 (83%) Frame = -2 Query: 402 PPERKYSVWIGGSILASL 349 PP RK+ V++GG++LA + Sbjct: 373 PPRRKHMVYLGGAVLAGI 390 >03_05_0644 + 26376544-26376929,26377013-26377193,26377314-26379017 Length = 756 Score = 27.5 bits (58), Expect = 6.5 Identities = 17/35 (48%), Positives = 19/35 (54%), Gaps = 1/35 (2%) Frame = -1 Query: 328 DLETGVRRVWPL-HCTQEVLLNAPRVLPPAARGRL 227 DL+ GV + L C V APRVLPP AR L Sbjct: 202 DLDDGVNGWFGLGSCALSVHGGAPRVLPPMARQSL 236 >01_01_0292 - 2387653-2387711,2388061-2388684,2388814-2389104, 2389338-2389390,2390496-2390968,2391090-2391432, 2391793-2391911,2392081-2392512,2392657-2392747, 2392833-2392942,2393681-2393875,2394581-2394622, 2395144-2395268,2395856-2395926,2396047-2396147 Length = 1042 Score = 27.5 bits (58), Expect = 6.5 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -2 Query: 378 WIGGSILASLSTFQQMWISKQEYDESGPSIVHRK 277 W G + A+ S F + S +Y E G ++ HRK Sbjct: 669 WRGAAAFAASSKFGRHTFSLADYREHGENLFHRK 702 >07_03_0463 - 18449908-18450171,18450718-18450810,18451170-18451254, 18451607-18451705,18452099-18452238,18453036-18453482 Length = 375 Score = 27.1 bits (57), Expect = 8.7 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = +2 Query: 170 ITIISYVQLN*RRLQA*IEQPAAGCWR 250 +T + +V L RLQ +E PAA CWR Sbjct: 245 LTFVPFVVL---RLQKFLESPAATCWR 268 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,392,281 Number of Sequences: 37544 Number of extensions: 282120 Number of successful extensions: 727 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 713 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 726 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1083123860 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -