BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1090 (419 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1420.04c |cox1101|cox11, SPAPB17E12.01c, cox11|fusion cytoch... 25 6.3 SPAC19B12.13 |cox1102|cox11, cox11-b, cox11, SPAPB8E5.01|fusion ... 25 6.3 SPAC144.14 |klp8||kinesin-like protein Klp8|Schizosaccharomyces ... 25 6.3 SPBC776.07 |||mitochondrial Mam33 family protein|Schizosaccharom... 24 8.4 >SPAC1420.04c |cox1101|cox11, SPAPB17E12.01c, cox11|fusion cytochrome c oxidase assembly protein Cox1101, mitochondrial ribosomal protein Rsm22|Schizosaccharomyces pombe|chr 1|||Manual Length = 753 Score = 24.6 bits (51), Expect = 6.3 Identities = 7/19 (36%), Positives = 15/19 (78%) Frame = +2 Query: 47 KQYYSTNKYLIFTKISSYN 103 K++YSTN++ F++ + +N Sbjct: 513 KRFYSTNRHKAFSRFADFN 531 >SPAC19B12.13 |cox1102|cox11, cox11-b, cox11, SPAPB8E5.01|fusion cytochrome c oxidase assembly protein Cox1102, mitochondrial ribosomal protein Rsm2202|Schizosaccharomyces pombe|chr 1|||Manual Length = 753 Score = 24.6 bits (51), Expect = 6.3 Identities = 7/19 (36%), Positives = 15/19 (78%) Frame = +2 Query: 47 KQYYSTNKYLIFTKISSYN 103 K++YSTN++ F++ + +N Sbjct: 513 KRFYSTNRHKAFSRFADFN 531 >SPAC144.14 |klp8||kinesin-like protein Klp8|Schizosaccharomyces pombe|chr 1|||Manual Length = 511 Score = 24.6 bits (51), Expect = 6.3 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +2 Query: 20 INNKYNVDCKQYYSTN 67 I N N++CK+ YSTN Sbjct: 356 IKNISNINCKEAYSTN 371 >SPBC776.07 |||mitochondrial Mam33 family protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 269 Score = 24.2 bits (50), Expect = 8.4 Identities = 14/39 (35%), Positives = 23/39 (58%) Frame = -1 Query: 266 LR*LKVRCAICRTIRKETSNACYSPLFRKSIIIRLQMSP 150 LR LK+ ++ R+IR SN C + L R + ++L +P Sbjct: 4 LRVLKIFRSVSRSIRIPASNGCIN-LGRNAYRVQLAKAP 41 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,560,559 Number of Sequences: 5004 Number of extensions: 27964 Number of successful extensions: 61 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 61 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 61 length of database: 2,362,478 effective HSP length: 66 effective length of database: 2,032,214 effective search space used: 148351622 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -