BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1090 (419 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g33060.1 68415.m04054 leucine-rich repeat family protein cont... 27 6.8 >At2g33060.1 68415.m04054 leucine-rich repeat family protein contains leucine rich-repeat domains Pfam:PF00560, INTERPRO:IPR001611; contains similarity to Hcr2-0B [Lycopersicon esculentum] gi|3894387|gb|AAC78593 Length = 808 Score = 26.6 bits (56), Expect = 6.8 Identities = 24/79 (30%), Positives = 38/79 (48%), Gaps = 10/79 (12%) Frame = +2 Query: 53 YYSTNKYL-----IFTKISSYNF*DISHNSYTLKRQLLE--TFVVLLLCSY---ETRVSN 202 Y S+N +L F+ +S N D+SHN T ++ T + +L+ SY + + Sbjct: 128 YLSSNGFLGQVPSSFSNLSQLNILDLSHNELTGSFPFVQNLTKLSILVLSYNHFSGTIPS 187 Query: 203 TRLKSPFVSSCKLHIVLLT 259 + L PF+SS L LT Sbjct: 188 SLLTLPFLSSLDLRENYLT 206 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,757,067 Number of Sequences: 28952 Number of extensions: 132635 Number of successful extensions: 259 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 257 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 259 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 645327280 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -