BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1087 (469 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 24 0.71 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 23 2.2 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 23 2.2 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 22 3.8 AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic ac... 21 8.7 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 24.2 bits (50), Expect = 0.71 Identities = 8/25 (32%), Positives = 16/25 (64%) Frame = +3 Query: 384 RSPQWPVSYIPAFPSSYQFNFPKTT 458 +S W + +PA+ ++Y+ +FP T Sbjct: 197 KSGTWDIINVPAYLNTYKGDFPTET 221 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 22.6 bits (46), Expect = 2.2 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = +1 Query: 148 ASCIPHPWSTLHRMATLISSRRGLLHMLRISLLHHTC 258 A+C+ W+ ++ + L + LL LRI L TC Sbjct: 103 ATCVLSCWTNIYYIIILAWALFYLLVSLRIDLPWRTC 139 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 22.6 bits (46), Expect = 2.2 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = +1 Query: 148 ASCIPHPWSTLHRMATLISSRRGLLHMLRISLLHHTC 258 A+C+ W+ ++ + L + LL LRI L TC Sbjct: 156 ATCVLSCWTNIYYIIILAWALFYLLVSLRIDLPWRTC 192 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 21.8 bits (44), Expect = 3.8 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = +2 Query: 161 LTLGLLYTVWLHSFHQEEVCCT 226 L +LY ++L++ EV CT Sbjct: 681 LARSVLYKIYLNTMESHEVRCT 702 >AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic acetylcholine receptoralpha-3 protein. Length = 537 Score = 20.6 bits (41), Expect = 8.7 Identities = 8/23 (34%), Positives = 16/23 (69%) Frame = +3 Query: 297 LLSWLRPPTVSSIPLISQPIAYS 365 LL+ + PPT +IPL+ + + ++ Sbjct: 297 LLAEIIPPTSLAIPLLGKYLLFT 319 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 122,226 Number of Sequences: 438 Number of extensions: 2425 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 12559158 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -