BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1084 (417 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC16E9.10c |||AAA family ATPase Rix7 |Schizosaccharomyces pomb... 26 2.7 SPAC22E12.04 |ccs1|pccs, pccs|metallochaperone Ccs1 |Schizosacch... 25 4.7 >SPBC16E9.10c |||AAA family ATPase Rix7 |Schizosaccharomyces pombe|chr 2|||Manual Length = 779 Score = 25.8 bits (54), Expect = 2.7 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = -1 Query: 411 NPNPASPQKLKPLAAAKGESTTGDRVHQKSVRRQG 307 +P+P SP++L+PLA + Q S +R+G Sbjct: 448 HPDPLSPEELEPLAICPQDFIEALAKVQPSSKREG 482 >SPAC22E12.04 |ccs1|pccs, pccs|metallochaperone Ccs1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 297 Score = 25.0 bits (52), Expect = 4.7 Identities = 11/34 (32%), Positives = 15/34 (44%) Frame = -1 Query: 390 QKLKPLAAAKGESTTGDRVHQKSVRRQGKCCLQK 289 Q K + A G+S + KSV CC +K Sbjct: 196 QNTKQICACTGKSLWTEHAELKSVNEGSSCCSKK 229 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,444,168 Number of Sequences: 5004 Number of extensions: 23933 Number of successful extensions: 60 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 57 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 60 length of database: 2,362,478 effective HSP length: 66 effective length of database: 2,032,214 effective search space used: 146319408 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -