BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1083 (444 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC093886-1|AAH93886.1| 471|Homo sapiens solute carrier family 1... 29 7.2 BC093860-1|AAH93860.1| 471|Homo sapiens solute carrier family 1... 29 7.2 AK074674-1|BAC11128.1| 471|Homo sapiens protein ( Homo sapiens ... 29 7.2 >BC093886-1|AAH93886.1| 471|Homo sapiens solute carrier family 16, member 11 (monocarboxylic acid transporter 11) protein. Length = 471 Score = 29.1 bits (62), Expect = 7.2 Identities = 20/57 (35%), Positives = 28/57 (49%), Gaps = 4/57 (7%) Frame = +1 Query: 148 SAYFCREAVMRFGLR---GGAAVVTIHETLELVSQG-GWRFTLWMSMGSSNHLTPGG 306 S YF R V+ GL GA+ + + L+L+ GWR L + + HLTP G Sbjct: 155 SRYFSRRRVLAVGLALTGNGASSLLLAPALQLLLDTFGWRGALLLLGAITLHLTPCG 211 >BC093860-1|AAH93860.1| 471|Homo sapiens solute carrier family 16, member 11 (monocarboxylic acid transporter 11) protein. Length = 471 Score = 29.1 bits (62), Expect = 7.2 Identities = 20/57 (35%), Positives = 28/57 (49%), Gaps = 4/57 (7%) Frame = +1 Query: 148 SAYFCREAVMRFGLR---GGAAVVTIHETLELVSQG-GWRFTLWMSMGSSNHLTPGG 306 S YF R V+ GL GA+ + + L+L+ GWR L + + HLTP G Sbjct: 155 SRYFSRRRVLAVGLALTGNGASSLLLAPALQLLLDTFGWRGALLLLGAITLHLTPCG 211 >AK074674-1|BAC11128.1| 471|Homo sapiens protein ( Homo sapiens cDNA FLJ90193 fis, clone MAMMA1001237, weakly similar to MONOCARBOXYLATE TRANSPORTER 2. ). Length = 471 Score = 29.1 bits (62), Expect = 7.2 Identities = 20/57 (35%), Positives = 28/57 (49%), Gaps = 4/57 (7%) Frame = +1 Query: 148 SAYFCREAVMRFGLR---GGAAVVTIHETLELVSQG-GWRFTLWMSMGSSNHLTPGG 306 S YF R V+ GL GA+ + + L+L+ GWR L + + HLTP G Sbjct: 155 SRYFSRRRVLAVGLALTGNGASSLLLAPALQLLLDTFGWRGALLLLGAITLHLTPCG 211 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 78,727,785 Number of Sequences: 237096 Number of extensions: 1903639 Number of successful extensions: 3510 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3308 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3510 length of database: 76,859,062 effective HSP length: 83 effective length of database: 57,180,094 effective search space used: 3659526016 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -