BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1083 (444 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 24 0.86 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 24 0.86 DQ485319-1|ABF21078.1| 175|Apis mellifera icarapin variant 2 pr... 22 2.6 AB095514-1|BAC76336.1| 72|Apis mellifera ecdyson receptor prot... 21 4.6 AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor ... 21 6.1 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 23.8 bits (49), Expect = 0.86 Identities = 12/32 (37%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = -3 Query: 208 QRLPHPSNRNALL-LHGRNRQSGGTYPCRLTR 116 ++LP ++ LL L+G NR+ G Y C + R Sbjct: 372 RQLPGTGRQSELLRLNGINREDRGMYQCIVRR 403 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 23.8 bits (49), Expect = 0.86 Identities = 12/32 (37%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = -3 Query: 208 QRLPHPSNRNALL-LHGRNRQSGGTYPCRLTR 116 ++LP ++ LL L+G NR+ G Y C + R Sbjct: 372 RQLPGTGRQSELLRLNGINREDRGMYQCIVRR 403 >DQ485319-1|ABF21078.1| 175|Apis mellifera icarapin variant 2 precursor protein. Length = 175 Score = 22.2 bits (45), Expect = 2.6 Identities = 10/35 (28%), Positives = 15/35 (42%) Frame = -3 Query: 418 TALHPK*AEWWYLPVQTHKMSYHQYFFLLLRWVDE 314 T L P + WY +QTH + +L + E Sbjct: 30 TLLRPNFLDGWYQTLQTHMKKVREQMAGILSRIPE 64 >AB095514-1|BAC76336.1| 72|Apis mellifera ecdyson receptor protein. Length = 72 Score = 21.4 bits (43), Expect = 4.6 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = -1 Query: 375 CRLTRCLTISIFFYCL 328 CRL +CLT+ + C+ Sbjct: 39 CRLKKCLTVGMRPECM 54 >AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor A isoform protein. Length = 567 Score = 21.0 bits (42), Expect = 6.1 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = -1 Query: 375 CRLTRCLTISIFFYCL 328 CRL +CLT+ + C+ Sbjct: 242 CRLKKCLTVGMRPECV 257 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 144,294 Number of Sequences: 438 Number of extensions: 3418 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 11574126 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -