BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1079 (450 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 23 1.8 EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglu... 21 7.1 U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. 20 9.4 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 22.6 bits (46), Expect = 1.8 Identities = 12/36 (33%), Positives = 16/36 (44%) Frame = -2 Query: 446 PPFPGPMKILKESLLLQRGSTPYGSVDRSSPPSLPS 339 P P +L E L RG V + PP+LP+ Sbjct: 96 PRCPSGESMLSERAALLRGVPTLSPVGVALPPTLPA 131 Score = 21.4 bits (43), Expect = 4.0 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = -2 Query: 347 LPSNKCGSRNKSTTSLAPPLYTG 279 LP+++C SR S + + P +G Sbjct: 79 LPNSRCNSRESSDSLVQPRCPSG 101 >EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglucosaminidase NAG3 protein. Length = 582 Score = 20.6 bits (41), Expect = 7.1 Identities = 6/12 (50%), Positives = 8/12 (66%) Frame = -3 Query: 316 RVRRVWPLHCTQ 281 R +WPL C+Q Sbjct: 566 RTAAIWPLWCSQ 577 >U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. Length = 425 Score = 20.2 bits (40), Expect = 9.4 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = -1 Query: 441 IPGTNEDFKGIIAPPER 391 IPG N K IAP ER Sbjct: 301 IPGQNPGEKTNIAPRER 317 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 103,033 Number of Sequences: 336 Number of extensions: 1968 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 10195961 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -