BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1079 (450 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB023025-1|BAA74592.1| 133|Apis mellifera actin protein. 66 2e-13 L10710-1|AAA27730.1| 382|Apis mellifera hyaluronidase protein. 21 6.2 AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly pro... 21 8.2 >AB023025-1|BAA74592.1| 133|Apis mellifera actin protein. Length = 133 Score = 65.7 bits (153), Expect = 2e-13 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -1 Query: 411 IIAPPERKYSVWIGGSILASLSTFQQMWIS 322 IIAPPE+KYSVWIGGSILASLSTFQQMWIS Sbjct: 104 IIAPPEKKYSVWIGGSILASLSTFQQMWIS 133 >L10710-1|AAA27730.1| 382|Apis mellifera hyaluronidase protein. Length = 382 Score = 21.0 bits (42), Expect = 6.2 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = -1 Query: 342 FQQMWISKQEYDESGPSIVHRK 277 F+Q W S Q Y + +V R+ Sbjct: 151 FRQNWASLQPYKKLSVEVVRRE 172 >AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly protein MRJP6 protein. Length = 437 Score = 20.6 bits (41), Expect = 8.2 Identities = 5/12 (41%), Positives = 7/12 (58%) Frame = +2 Query: 221 IEQPAAGCWRQH 256 + A GCW +H Sbjct: 323 VNNSAIGCWNEH 334 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 128,173 Number of Sequences: 438 Number of extensions: 2893 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 11820384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -