BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1079 (450 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g09810.1 68418.m01135 actin 7 (ACT7) / actin 2 identical to S... 102 1e-22 At5g59370.1 68418.m07440 actin 4 (ACT4) identical to SP|P53494 A... 100 4e-22 At3g53750.1 68416.m05938 actin 3 (ACT3) identical to SP|P53493 A... 100 4e-22 At3g46520.1 68416.m05050 actin 12 (ACT12) identical to SP|P53497... 100 4e-22 At3g12110.1 68416.m01507 actin 11 (ACT11) identical to SP|P53496... 100 4e-22 At2g37620.1 68415.m04615 actin 1 (ACT1) identical to SP|P10671 A... 100 4e-22 At3g18780.2 68416.m02386 actin 2 (ACT2) identical to SP|Q96292 A... 99 1e-21 At1g49240.1 68414.m05520 actin 8 (ACT8) identical to SP|Q96293 A... 99 1e-21 At2g42170.1 68415.m05219 actin, putative similar to actin 2 [Ara... 92 1e-19 At2g42100.1 68415.m05205 actin, putative very strong similarity ... 87 4e-18 At2g42090.1 68415.m05204 actin, putative similar to SP|P53496 Ac... 79 1e-15 At1g18450.1 68414.m02302 actin-related protein 4 (ARP4) neary id... 70 6e-13 At3g18780.1 68416.m02385 actin 2 (ACT2) identical to SP|Q96292 A... 58 4e-09 At3g60830.1 68416.m06805 actin-related protein 7 (ARP7) identica... 57 5e-09 At1g13180.1 68414.m01528 actin-related protein 3 (ARP3) identica... 41 4e-04 At3g33520.1 68416.m04291 actin-related protein 6 (ARP6) nearly i... 40 0.001 At3g27000.1 68416.m03378 actin-related protein 2 (ARP2) nearly i... 38 0.003 At1g20110.1 68414.m02516 zinc finger (FYVE type) family protein ... 28 3.4 At2g20920.1 68415.m02467 expressed protein 27 5.9 At1g58370.1 68414.m06640 glycosyl hydrolase family 10 protein / ... 27 5.9 At5g43500.2 68418.m05318 expressed protein 27 7.7 At5g43500.1 68418.m05319 expressed protein 27 7.7 At3g26310.1 68416.m03283 cytochrome P450 family protein contains... 27 7.7 At3g18890.1 68416.m02399 expressed protein similar to UV-B and o... 27 7.7 At1g26850.2 68414.m03274 dehydration-responsive family protein s... 27 7.7 At1g26850.1 68414.m03273 dehydration-responsive family protein s... 27 7.7 >At5g09810.1 68418.m01135 actin 7 (ACT7) / actin 2 identical to SP|P53492 Actin 7 (Actin-2) {Arabidopsis thaliana} Length = 377 Score = 102 bits (244), Expect = 1e-22 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -1 Query: 411 IIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 271 ++APPERKYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 331 VVAPPERKYSVWIGGSILASLSTFQQMWISKSEYDESGPSIVHRKCF 377 >At5g59370.1 68418.m07440 actin 4 (ACT4) identical to SP|P53494 Actin 4 {Arabidopsis thaliana} Length = 377 Score = 100 bits (240), Expect = 4e-22 Identities = 43/47 (91%), Positives = 46/47 (97%) Frame = -1 Query: 411 IIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 271 ++APPERKYSVWIGGSILASLSTFQQMWI+K EYDESGPSIVHRKCF Sbjct: 331 VVAPPERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 377 >At3g53750.1 68416.m05938 actin 3 (ACT3) identical to SP|P53493 Actin 3 {Arabidopsis thaliana}; supported by full-length cDNA: Ceres: 19581. Length = 377 Score = 100 bits (240), Expect = 4e-22 Identities = 43/47 (91%), Positives = 46/47 (97%) Frame = -1 Query: 411 IIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 271 ++APPERKYSVWIGGSILASLSTFQQMWI+K EYDESGPSIVHRKCF Sbjct: 331 VVAPPERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 377 >At3g46520.1 68416.m05050 actin 12 (ACT12) identical to SP|P53497 Actin 12 {Arabidopsis thaliana} Length = 377 Score = 100 bits (240), Expect = 4e-22 Identities = 43/47 (91%), Positives = 46/47 (97%) Frame = -1 Query: 411 IIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 271 ++APPERKYSVWIGGSILASLSTFQQMWI+K EYDESGPSIVHRKCF Sbjct: 331 VVAPPERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 377 >At3g12110.1 68416.m01507 actin 11 (ACT11) identical to SP|P53496 Actin 11 {Arabidopsis thaliana} Length = 377 Score = 100 bits (240), Expect = 4e-22 Identities = 43/47 (91%), Positives = 46/47 (97%) Frame = -1 Query: 411 IIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 271 ++APPERKYSVWIGGSILASLSTFQQMWI+K EYDESGPSIVHRKCF Sbjct: 331 VVAPPERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 377 >At2g37620.1 68415.m04615 actin 1 (ACT1) identical to SP|P10671 Actin 1 (Actin 3) {Arabidopsis thaliana} Length = 377 Score = 100 bits (240), Expect = 4e-22 Identities = 43/47 (91%), Positives = 46/47 (97%) Frame = -1 Query: 411 IIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 271 ++APPERKYSVWIGGSILASLSTFQQMWI+K EYDESGPSIVHRKCF Sbjct: 331 VVAPPERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 377 >At3g18780.2 68416.m02386 actin 2 (ACT2) identical to SP|Q96292 Actin 2 {Arabidopsis thaliana}; nearly identical to SP|Q96293 Actin 8 [Arabidopsis thaliana] GI:1669387 and to At1g49240 Length = 377 Score = 99.1 bits (236), Expect = 1e-21 Identities = 42/47 (89%), Positives = 45/47 (95%) Frame = -1 Query: 411 IIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 271 ++APPERKYSVWIGGSILASLSTFQQMWISK EYDE+GP IVHRKCF Sbjct: 331 VVAPPERKYSVWIGGSILASLSTFQQMWISKAEYDEAGPGIVHRKCF 377 >At1g49240.1 68414.m05520 actin 8 (ACT8) identical to SP|Q96293 Actin 8 {Arabidopsis thaliana}; nearly identical to SP|Q96292 Actin 2 [Arabidopsis thaliana] GI:1669387, and to At3g18780 Length = 377 Score = 99.1 bits (236), Expect = 1e-21 Identities = 42/47 (89%), Positives = 45/47 (95%) Frame = -1 Query: 411 IIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 271 ++APPERKYSVWIGGSILASLSTFQQMWISK EYDE+GP IVHRKCF Sbjct: 331 VVAPPERKYSVWIGGSILASLSTFQQMWISKAEYDEAGPGIVHRKCF 377 >At2g42170.1 68415.m05219 actin, putative similar to actin 2 [Arabidopsis thaliana] gi|9293903|dbj|BAB01806 Length = 329 Score = 92.3 bits (219), Expect = 1e-19 Identities = 38/47 (80%), Positives = 45/47 (95%) Frame = -1 Query: 411 IIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 271 I+APPERKYSVWIGGSILASLST++QMWI+K EY+E+GP+IVH KCF Sbjct: 283 IVAPPERKYSVWIGGSILASLSTYEQMWITKAEYEENGPAIVHTKCF 329 >At2g42100.1 68415.m05205 actin, putative very strong similarity to SP|P53496 Actin 11 {Arabidopsis thaliana}, SP|P53493 Actin 3 {Arabidopsis thaliana}; contains Pfam profile PF00022: Actin Length = 378 Score = 87.4 bits (207), Expect = 4e-18 Identities = 36/47 (76%), Positives = 42/47 (89%) Frame = -1 Query: 411 IIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 271 ++APPERKYSVW+GGSILASLS+F MWI+K EYDE G +IVHRKCF Sbjct: 332 VVAPPERKYSVWVGGSILASLSSFAPMWITKAEYDEQGGAIVHRKCF 378 >At2g42090.1 68415.m05204 actin, putative similar to SP|P53496 Actin 11 {Arabidopsis thaliana}; contains Pfam profile PF00022: Actin Length = 366 Score = 79.4 bits (187), Expect = 1e-15 Identities = 33/46 (71%), Positives = 39/46 (84%) Frame = -1 Query: 411 IIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKC 274 ++ PPE + SVWIGGSILASLSTF QMWI+K EY+E G +IVHRKC Sbjct: 320 VVVPPESECSVWIGGSILASLSTFHQMWITKDEYEEHGAAIVHRKC 365 >At1g18450.1 68414.m02302 actin-related protein 4 (ARP4) neary identical to actin-related protein 4 (ARP4) [Arabidopsis thaliana] GI:21427463; contains Pfam profile PF00022: Actin; supporting cDNA gi|21427462|gb|AF507912.1| Length = 441 Score = 70.1 bits (164), Expect = 6e-13 Identities = 29/41 (70%), Positives = 34/41 (82%) Frame = -1 Query: 396 ERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKC 274 ER++SVWIGGSILASL +FQQMW SK EY+E G S + RKC Sbjct: 400 ERRFSVWIGGSILASLGSFQQMWFSKSEYEEHGASYIQRKC 440 >At3g18780.1 68416.m02385 actin 2 (ACT2) identical to SP|Q96292 Actin 2 {Arabidopsis thaliana}; nearly identical to SP|Q96293 Actin 8 [Arabidopsis thaliana] GI:1669387 and to At1g49240 Length = 371 Score = 57.6 bits (133), Expect = 4e-09 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -1 Query: 411 IIAPPERKYSVWIGGSILASLSTFQQMWISK 319 ++APPERKYSVWIGGSILASLSTFQQ+ I + Sbjct: 331 VVAPPERKYSVWIGGSILASLSTFQQVKIDQ 361 >At3g60830.1 68416.m06805 actin-related protein 7 (ARP7) identical to actin-related protein 7 (ARP7) [Arabidopsis thaliana] GI:21427469; contains Pfam profile PF00022: Actin Length = 363 Score = 57.2 bits (132), Expect = 5e-09 Identities = 22/39 (56%), Positives = 30/39 (76%) Frame = -1 Query: 387 YSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 271 YS W+GG+ILA + Q ++K +YDE+GPS+VHRKCF Sbjct: 325 YSAWVGGAILAKVVFPQNQHVTKADYDETGPSVVHRKCF 363 >At1g13180.1 68414.m01528 actin-related protein 3 (ARP3) identical to actin-related protein 3 (ARP3) [Arabidopsis thaliana] GI:21427461; contains Pfam profile PF00022: Actin Length = 427 Score = 40.7 bits (91), Expect = 4e-04 Identities = 16/41 (39%), Positives = 28/41 (68%) Frame = -1 Query: 411 IIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSI 289 +++ P ++++VW GGS+L+S F +K+EY+E G SI Sbjct: 376 VVSHPVQRFAVWFGGSVLSSTPEFFASCRTKEEYEEYGASI 416 >At3g33520.1 68416.m04291 actin-related protein 6 (ARP6) nearly identical to actin-related protein 6 (ARP6) [Arabidopsis thaliana] GI:21427467; contains Pfam profile PF00022: Actin Length = 421 Score = 39.5 bits (88), Expect = 0.001 Identities = 23/60 (38%), Positives = 33/60 (55%) Frame = -1 Query: 450 RPPIPGTNEDFKGIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 271 RP +P + D K I + VW GGS+LAS F+ M ++K EY+E G + R+ F Sbjct: 363 RPLVPD-HFDVK-ITTQEDPILGVWRGGSLLASSPDFESMCVTKAEYEELGSARCRRRFF 420 >At3g27000.1 68416.m03378 actin-related protein 2 (ARP2) nearly identical to actin-related protein 2 (ARP2) [Arabidopsis thaliana] GI:3818624; contains Pfam profile PF00022: Actin Length = 389 Score = 37.9 bits (84), Expect = 0.003 Identities = 14/42 (33%), Positives = 29/42 (69%), Gaps = 1/42 (2%) Frame = -1 Query: 402 PPERKYSVWIGGSILAS-LSTFQQMWISKQEYDESGPSIVHR 280 PP RK+ V++GG++LA + + WI++++Y E G + +++ Sbjct: 344 PPRRKHMVYLGGAVLAGIMKDAPEFWINREDYMEEGINCLNK 385 >At1g20110.1 68414.m02516 zinc finger (FYVE type) family protein contains Pfam profile: PF01363 FYVE zinc finger Length = 601 Score = 27.9 bits (59), Expect = 3.4 Identities = 22/59 (37%), Positives = 25/59 (42%), Gaps = 3/59 (5%) Frame = -2 Query: 449 APPFPGPMKILKESLLLQRGSTPYGSVDRSSPPSLPSNKCGSR---NKSTTSLAPPLYT 282 APPF G S Q TPYG PPS PS S+ + TSL P Y+ Sbjct: 52 APPFTGGYGSADYSNYSQN-YTPYGQNSEHVPPSAPSFTSPSQPPPSPPATSLNPNSYS 109 >At2g20920.1 68415.m02467 expressed protein Length = 287 Score = 27.1 bits (57), Expect = 5.9 Identities = 15/44 (34%), Positives = 20/44 (45%) Frame = -3 Query: 361 PRLPLYLPTNVDLETRVRRVWPLHCTQEVLLNAPRVLPPAARGR 230 P PLYLPT + +R ++W +L R PP A R Sbjct: 22 PLHPLYLPTKLQFPSRKTQLW--RSAAILLPTRRRCAPPRASSR 63 >At1g58370.1 68414.m06640 glycosyl hydrolase family 10 protein / carbohydrate-binding domain-containing protein similar to (1,4)-beta-xylan endohydrolase GI:5306060 from [Triticum aestivum] ; contains Pfam profiles PF00331: Glycosyl hydrolase family 10, PF02018: Carbohydrate binding domain Length = 917 Score = 27.1 bits (57), Expect = 5.9 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -3 Query: 292 HCTQEVLLNAPRVLPPAARGRL 227 +CT V +PR+LPP AR L Sbjct: 389 NCTLSVAEGSPRILPPMARDSL 410 >At5g43500.2 68418.m05318 expressed protein Length = 584 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = -1 Query: 396 ERKYSVWIGGSILASLSTFQQMWISKQEYDESG 298 E ++ W GG+IL L ++ WI + ++ +G Sbjct: 527 EPQFVTWKGGAILGILDFGREAWIERHQWMVNG 559 >At5g43500.1 68418.m05319 expressed protein Length = 596 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = -1 Query: 396 ERKYSVWIGGSILASLSTFQQMWISKQEYDESG 298 E ++ W GG+IL L ++ WI + ++ +G Sbjct: 539 EPQFVTWKGGAILGILDFGREAWIERHQWMVNG 571 >At3g26310.1 68416.m03283 cytochrome P450 family protein contains Pfam profile: PF00067 cytochrome P450 Length = 500 Score = 26.6 bits (56), Expect = 7.7 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = -3 Query: 358 RLPLYLPTNVDLETRVRRVWPLHCTQEVLLNAPRVL 251 R+P + ++ D +V RV LHC L+ PR L Sbjct: 71 RVPTVVVSSSDTARQVLRVHDLHCCTRPSLSGPREL 106 >At3g18890.1 68416.m02399 expressed protein similar to UV-B and ozone similarly regulated protein 1 UOS1 [Pisum sativum] GI:20339364 Length = 641 Score = 26.6 bits (56), Expect = 7.7 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = -2 Query: 398 QRGSTPYGSVDRSSPPSLPSNKCGSRNKSTTSLAP 294 +R +PY + PPS PS S KS SL+P Sbjct: 442 ERPLSPYARYENLKPPSSPSPTASSTRKS-DSLSP 475 >At1g26850.2 68414.m03274 dehydration-responsive family protein similar to early-responsive to dehydration stress ERD3 protein [Arabidopsis thaliana] GI:15320410; contains Pfam profile PF03141: Putative methyltransferase Length = 616 Score = 26.6 bits (56), Expect = 7.7 Identities = 11/38 (28%), Positives = 23/38 (60%) Frame = -3 Query: 415 RNHCSSREEVLRMDRWIDPRLPLYLPTNVDLETRVRRV 302 +N C++ + +L MDR + P + + +VD +V+R+ Sbjct: 540 KNKCNADDILLEMDRILRPEGAVIIRDDVDTLIKVKRI 577 >At1g26850.1 68414.m03273 dehydration-responsive family protein similar to early-responsive to dehydration stress ERD3 protein [Arabidopsis thaliana] GI:15320410; contains Pfam profile PF03141: Putative methyltransferase Length = 616 Score = 26.6 bits (56), Expect = 7.7 Identities = 11/38 (28%), Positives = 23/38 (60%) Frame = -3 Query: 415 RNHCSSREEVLRMDRWIDPRLPLYLPTNVDLETRVRRV 302 +N C++ + +L MDR + P + + +VD +V+R+ Sbjct: 540 KNKCNADDILLEMDRILRPEGAVIIRDDVDTLIKVKRI 577 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,458,029 Number of Sequences: 28952 Number of extensions: 185367 Number of successful extensions: 509 Number of sequences better than 10.0: 26 Number of HSP's better than 10.0 without gapping: 495 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 508 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 732537840 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -