BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1077 (435 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC041125-1|AAH41125.1| 787|Homo sapiens KIAA1586 protein. 29 9.1 AL450489-1|CAH71219.1| 787|Homo sapiens protein ( Human DNA seq... 29 9.1 >BC041125-1|AAH41125.1| 787|Homo sapiens KIAA1586 protein. Length = 787 Score = 28.7 bits (61), Expect = 9.1 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = -1 Query: 102 PSRPCFRASPLLCYDDNGLTAYNANMIFVK 13 PSRP L+C DD +AY ++++F K Sbjct: 38 PSRPVLEYIDLVCGDDENPSAYYSDILFPK 67 >AL450489-1|CAH71219.1| 787|Homo sapiens protein ( Human DNA sequence from clone RP11-203B9 on chromosome 6 Contains the 3 'end of gene FLJ30162, a novel gene, the 5'end of gene ). Length = 787 Score = 28.7 bits (61), Expect = 9.1 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = -1 Query: 102 PSRPCFRASPLLCYDDNGLTAYNANMIFVK 13 PSRP L+C DD +AY ++++F K Sbjct: 38 PSRPVLEYIDLVCGDDENPSAYYSDILFPK 67 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 56,028,349 Number of Sequences: 237096 Number of extensions: 975944 Number of successful extensions: 2865 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2850 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2865 length of database: 76,859,062 effective HSP length: 83 effective length of database: 57,180,094 effective search space used: 3487985734 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -