BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1075 (422 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_7202| Best HMM Match : UQ_con (HMM E-Value=5.9e-05) 106 9e-24 SB_33407| Best HMM Match : UQ_con (HMM E-Value=0) 106 9e-24 SB_33408| Best HMM Match : UQ_con (HMM E-Value=3.7e-07) 83 9e-17 SB_44322| Best HMM Match : UQ_con (HMM E-Value=1.6e-37) 75 2e-14 SB_28696| Best HMM Match : UQ_con (HMM E-Value=5.3e-30) 72 2e-13 SB_15708| Best HMM Match : UQ_con (HMM E-Value=0) 62 2e-10 SB_21041| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 7e-09 SB_28812| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-08 SB_5638| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 5e-07 SB_26407| Best HMM Match : UQ_con (HMM E-Value=0) 48 4e-06 SB_3717| Best HMM Match : UQ_con (HMM E-Value=0.00017) 47 6e-06 SB_47222| Best HMM Match : UQ_con (HMM E-Value=5) 47 7e-06 SB_41378| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_57663| Best HMM Match : UQ_con (HMM E-Value=0.24) 44 7e-05 SB_30411| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 3e-04 SB_36444| Best HMM Match : UQ_con (HMM E-Value=2.8) 40 8e-04 SB_26077| Best HMM Match : UQ_con (HMM E-Value=6e-18) 40 8e-04 SB_9528| Best HMM Match : 7tm_1 (HMM E-Value=2.6e-39) 40 8e-04 SB_26076| Best HMM Match : UQ_con (HMM E-Value=3.6e-15) 38 0.003 SB_26178| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.098 SB_26761| Best HMM Match : UQ_con (HMM E-Value=1.7e-06) 33 0.13 SB_4905| Best HMM Match : Mito_carr (HMM E-Value=3.3e-13) 30 0.91 SB_26293| Best HMM Match : WD40 (HMM E-Value=1.1e-15) 29 1.6 SB_43290| Best HMM Match : AMP-binding (HMM E-Value=6.5e-16) 29 2.1 SB_11967| Best HMM Match : Pollen_allerg_2 (HMM E-Value=1.7) 28 2.8 SB_35857| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.7 SB_33210| Best HMM Match : Spectrin (HMM E-Value=1.3e-12) 28 3.7 SB_5453| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.7 SB_292| Best HMM Match : HEAT (HMM E-Value=4.6e-29) 28 3.7 SB_24498| Best HMM Match : Galactosyl_T_2 (HMM E-Value=0) 27 6.4 SB_9755| Best HMM Match : Sushi (HMM E-Value=0) 27 6.4 SB_45371| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.4 SB_59018| Best HMM Match : Calx-beta (HMM E-Value=2.2) 27 8.5 SB_45042| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.5 SB_1836| Best HMM Match : zf-C2H2 (HMM E-Value=0.0016) 27 8.5 SB_57341| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.5 >SB_7202| Best HMM Match : UQ_con (HMM E-Value=5.9e-05) Length = 200 Score = 106 bits (254), Expect = 9e-24 Identities = 44/69 (63%), Positives = 52/69 (75%) Frame = +2 Query: 41 NSQMALKRINRELQDLGRDPPAQCSAGPHGEDLFHWQATIMGPVDSPYQGGVFFLTIHFP 220 N A KRI REL ++ DPP CSAGP G+DL+ W +TI+GP S Y+GGVFFL IHFP Sbjct: 132 NQSTAAKRIQRELTEITLDPPPNCSAGPKGDDLYEWYSTILGPPGSVYEGGVFFLDIHFP 191 Query: 221 TDYPFKPPK 247 +DYPFKPPK Sbjct: 192 SDYPFKPPK 200 >SB_33407| Best HMM Match : UQ_con (HMM E-Value=0) Length = 226 Score = 106 bits (254), Expect = 9e-24 Identities = 44/69 (63%), Positives = 52/69 (75%) Frame = +2 Query: 41 NSQMALKRINRELQDLGRDPPAQCSAGPHGEDLFHWQATIMGPVDSPYQGGVFFLTIHFP 220 N A KRI REL ++ DPP CSAGP G+DL+ W +TI+GP S Y+GGVFFL IHFP Sbjct: 92 NQSTAAKRIQRELTEITLDPPPNCSAGPKGDDLYEWYSTILGPPGSVYEGGVFFLDIHFP 151 Query: 221 TDYPFKPPK 247 +DYPFKPPK Sbjct: 152 SDYPFKPPK 160 Score = 67.7 bits (158), Expect = 4e-12 Identities = 31/39 (79%), Positives = 33/39 (84%) Frame = +1 Query: 292 GSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLV 408 G +CLDIL+ WSPALTISKVLLSICSLL D NP DPLV Sbjct: 161 GMVCLDILKDSWSPALTISKVLLSICSLLTDCNPADPLV 199 >SB_33408| Best HMM Match : UQ_con (HMM E-Value=3.7e-07) Length = 181 Score = 83.0 bits (196), Expect = 9e-17 Identities = 44/88 (50%), Positives = 54/88 (61%) Frame = +2 Query: 113 SAGPHGEDLFHWQATIMGPVDSPYQGGVFFLTIHFPTDYPFKPPKVASQHVFIILT*TVM 292 SAGP G+ L+ W +TI+GP S Y+GGVFFL IHFPTDYPFKPPKV Q + + L T Sbjct: 43 SAGPKGDKLYEWYSTILGPPGSVYEGGVFFLDIHFPTDYPFKPPKV-GQAIRLSLYTTES 101 Query: 293 VPSVLTFCVHSGHQRSPYPKCCSQSAHF 376 PS + HQR Y + +A F Sbjct: 102 TPSYQ--IIPLNHQRF-YARVTDVNAFF 126 >SB_44322| Best HMM Match : UQ_con (HMM E-Value=1.6e-37) Length = 190 Score = 75.4 bits (177), Expect = 2e-14 Identities = 36/68 (52%), Positives = 44/68 (64%), Gaps = 4/68 (5%) Frame = +1 Query: 217 PYRLPFQTTKSCITTRIYHPNINSNGSICLDIL----RAQWSPALTISKVLLSICSLLCD 384 P R PF+ K T IYHPNI+S+G ICLD L + W PAL IS VL +I L+ + Sbjct: 22 PERYPFEPPKVRFVTPIYHPNIDSSGRICLDTLKMPPKGMWKPALNISSVLSTILILMAE 81 Query: 385 PNPDDPLV 408 PNPDDPL+ Sbjct: 82 PNPDDPLM 89 Score = 38.3 bits (85), Expect = 0.003 Identities = 15/31 (48%), Positives = 20/31 (64%) Frame = +2 Query: 158 IMGPVDSPYQGGVFFLTIHFPTDYPFKPPKV 250 ++G +PY G+F L I P YPF+PPKV Sbjct: 2 LIGAEGTPYHKGIFKLDIQIPERYPFEPPKV 32 >SB_28696| Best HMM Match : UQ_con (HMM E-Value=5.3e-30) Length = 204 Score = 71.7 bits (168), Expect = 2e-13 Identities = 34/64 (53%), Positives = 42/64 (65%), Gaps = 4/64 (6%) Frame = +1 Query: 229 PFQTTKSCITTRIYHPNINSNGSICLDILR----AQWSPALTISKVLLSICSLLCDPNPD 396 PF+ K T IYHPNI+S+G ICLD L+ W PAL IS VL +I L+ +PNPD Sbjct: 40 PFEPPKVRFVTPIYHPNIDSSGRICLDTLKMPPKGMWKPALNISSVLSTILILMAEPNPD 99 Query: 397 DPLV 408 DPL+ Sbjct: 100 DPLM 103 >SB_15708| Best HMM Match : UQ_con (HMM E-Value=0) Length = 145 Score = 62.1 bits (144), Expect = 2e-10 Identities = 26/65 (40%), Positives = 39/65 (60%), Gaps = 1/65 (1%) Frame = +1 Query: 214 FPYRLPFQTTKSCITTRIYHPNINSNGSICLDILRAQ-WSPALTISKVLLSICSLLCDPN 390 FP PF+ K T+IYHPNI+ G +CL I+ + W PA +V+ ++ +L+ DP Sbjct: 48 FPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPIISPENWKPATKTEQVIQALLALVHDPE 107 Query: 391 PDDPL 405 P+ PL Sbjct: 108 PEHPL 112 Score = 44.4 bits (100), Expect = 4e-05 Identities = 18/39 (46%), Positives = 25/39 (64%) Frame = +2 Query: 134 DLFHWQATIMGPVDSPYQGGVFFLTIHFPTDYPFKPPKV 250 ++ +WQ I+ P PY G F + I FP +YPFKPPK+ Sbjct: 22 NILYWQGLIV-PEMPPYNKGAFRIEICFPAEYPFKPPKI 59 >SB_21041| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 269 Score = 56.8 bits (131), Expect = 7e-09 Identities = 23/49 (46%), Positives = 33/49 (67%) Frame = +1 Query: 259 TRIYHPNINSNGSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPL 405 T+I+HPN+ NG IC++ L+ W P L I +VLL++ LL PNP+ L Sbjct: 149 TKIFHPNVAKNGEICVNTLKKDWKPDLGIKQVLLTVKCLLIVPNPESAL 197 Score = 31.5 bits (68), Expect = 0.30 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = +2 Query: 44 SQMALKRINRELQDLGRDPPAQCSAGPHGEDLFHWQATIMGP 169 S +K++ RE+ L DPP + ED+ QA+I GP Sbjct: 103 SPQIIKQVAREIHGLTNDPPEGIKVFSNDEDITDIQASIEGP 144 >SB_28812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 385 Score = 54.4 bits (125), Expect = 4e-08 Identities = 29/79 (36%), Positives = 43/79 (54%) Frame = +2 Query: 14 VESQYNST*NSQMALKRINRELQDLGRDPPAQCSAGPHGEDLFHWQATIMGPVDSPYQGG 193 +E QYN A+KR+ RE ++L R+ A P ++LF W T+ GP D+ + GG Sbjct: 1 MEKQYNLR---SPAVKRLMREAKEL-RNATELYHAQPLEDNLFEWHFTVRGPPDTEFAGG 56 Query: 194 VFFLTIHFPTDYPFKPPKV 250 + I P +YP KPP + Sbjct: 57 RYHGRIILPPEYPMKPPSI 75 >SB_5638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 50.8 bits (116), Expect = 5e-07 Identities = 20/43 (46%), Positives = 27/43 (62%) Frame = +2 Query: 122 PHGEDLFHWQATIMGPVDSPYQGGVFFLTIHFPTDYPFKPPKV 250 P +D+ A I GP D+PY+GG F+ I P DYP +PP+V Sbjct: 5 PDKDDIPKIHALITGPFDTPYEGGFFYFLIRCPPDYPIRPPRV 47 >SB_26407| Best HMM Match : UQ_con (HMM E-Value=0) Length = 1282 Score = 47.6 bits (108), Expect = 4e-06 Identities = 26/94 (27%), Positives = 44/94 (46%), Gaps = 13/94 (13%) Frame = +1 Query: 160 YGPS*QSLSRRSFLPYHTFPYRLPFQTTKSCITTRIYHPNINSNGSICLDILR------- 318 +GP + F + +FP+ P+ T+++HPNI +G +C+ IL Sbjct: 1162 FGPPGTLYAGGYFKAHMSFPHDYPYSPPTFRFLTKMWHPNIYESGDVCISILHPPVDDPQ 1221 Query: 319 ------AQWSPALTISKVLLSICSLLCDPNPDDP 402 +W+P + +LLS+ SLL +PN P Sbjct: 1222 SGELPSERWNPTQNVRTILLSVISLLNEPNTFSP 1255 Score = 46.4 bits (105), Expect = 1e-05 Identities = 22/65 (33%), Positives = 32/65 (49%), Gaps = 1/65 (1%) Frame = +2 Query: 53 ALKRINRELQDLGRDPPAQCSAG-PHGEDLFHWQATIMGPVDSPYQGGVFFLTIHFPTDY 229 A++ + EL+ L +P + P + F W I GP + Y GG F + FP DY Sbjct: 1125 AVRALQLELKKLTEEPVEGFTVEVPDESNTFEWDVAIFGPPGTLYAGGYFKAHMSFPHDY 1184 Query: 230 PFKPP 244 P+ PP Sbjct: 1185 PYSPP 1189 >SB_3717| Best HMM Match : UQ_con (HMM E-Value=0.00017) Length = 123 Score = 47.2 bits (107), Expect = 6e-06 Identities = 20/53 (37%), Positives = 30/53 (56%) Frame = +2 Query: 131 EDLFHWQATIMGPVDSPYQGGVFFLTIHFPTDYPFKPPKVASQHVFIILT*TV 289 ++LF W T+ GP D+ + GG + I P +YP KPP + V++ T TV Sbjct: 1 DNLFEWHFTVRGPPDTEFAGGRYHGRIILPPEYPMKPPSIMLLTVWLYYTSTV 53 >SB_47222| Best HMM Match : UQ_con (HMM E-Value=5) Length = 46 Score = 46.8 bits (106), Expect = 7e-06 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 355 LLSICSLLCDPNPDDPLVP 411 LLSICSLLCDPNPDDPLVP Sbjct: 2 LLSICSLLCDPNPDDPLVP 20 >SB_41378| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 473 Score = 46.4 bits (105), Expect = 1e-05 Identities = 22/76 (28%), Positives = 37/76 (48%), Gaps = 13/76 (17%) Frame = +1 Query: 214 FPYRLPFQTTKSCITTRIYHPNINSNGSICLDILR-------------AQWSPALTISKV 354 FP P + + I+HPN++ NG +C+ IL +W P T+ + Sbjct: 388 FPKEYPQRPPTLTFISDIWHPNVHKNGEVCISILHEPGEDKYGYEKADERWRPIHTVETI 447 Query: 355 LLSICSLLCDPNPDDP 402 +LS+ S+L +PN + P Sbjct: 448 MLSVISMLAEPNDESP 463 Score = 43.2 bits (97), Expect = 9e-05 Identities = 20/55 (36%), Positives = 32/55 (58%), Gaps = 1/55 (1%) Frame = +2 Query: 83 DLGRDPPAQCSAGPHG-EDLFHWQATIMGPVDSPYQGGVFFLTIHFPTDYPFKPP 244 +L + P SAG EDL+ W+ ++GP + Y+ G F ++ FP +YP +PP Sbjct: 343 ELQKKPVEGFSAGLFDDEDLYKWEIMVVGPPGTYYEEGYFKASMVFPKEYPQRPP 397 >SB_57663| Best HMM Match : UQ_con (HMM E-Value=0.24) Length = 48 Score = 43.6 bits (98), Expect = 7e-05 Identities = 20/28 (71%), Positives = 22/28 (78%) Frame = +1 Query: 322 QWSPALTISKVLLSICSLLCDPNPDDPL 405 +WSPAL I VLLSI +LL PNPDDPL Sbjct: 2 KWSPALQIRTVLLSIQALLSAPNPDDPL 29 >SB_30411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 710 Score = 41.5 bits (93), Expect = 3e-04 Identities = 15/31 (48%), Positives = 22/31 (70%) Frame = +2 Query: 164 GPVDSPYQGGVFFLTIHFPTDYPFKPPKVAS 256 GPV +PY+GGV+ + + P YPFK P +A+ Sbjct: 56 GPVGTPYEGGVWKVRVDLPEKYPFKSPSIAN 86 >SB_36444| Best HMM Match : UQ_con (HMM E-Value=2.8) Length = 55 Score = 39.9 bits (89), Expect = 8e-04 Identities = 17/34 (50%), Positives = 20/34 (58%) Frame = +2 Query: 149 QATIMGPVDSPYQGGVFFLTIHFPTDYPFKPPKV 250 +A + GPVD+PY G F I FP YP PP V Sbjct: 9 RALVTGPVDTPYSRGCFVFDIFFPGTYPNVPPLV 42 >SB_26077| Best HMM Match : UQ_con (HMM E-Value=6e-18) Length = 215 Score = 39.9 bits (89), Expect = 8e-04 Identities = 19/55 (34%), Positives = 33/55 (60%), Gaps = 1/55 (1%) Frame = +1 Query: 250 CITTRIYHPNIN-SNGSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLVP 411 C+ IYHPN++ +GS+CL +L W+ + + ++ + L +PN +DPL P Sbjct: 73 CVNN-IYHPNMDLDDGSVCLSLLD-DWNESNDLEDLVQGLLFLFYNPNLEDPLSP 125 >SB_9528| Best HMM Match : 7tm_1 (HMM E-Value=2.6e-39) Length = 841 Score = 39.9 bits (89), Expect = 8e-04 Identities = 15/30 (50%), Positives = 20/30 (66%) Frame = +2 Query: 158 IMGPVDSPYQGGVFFLTIHFPTDYPFKPPK 247 I GP ++P++GG + L I P YPF PPK Sbjct: 693 IRGPPETPFEGGTYNLDIVIPETYPFNPPK 722 >SB_26076| Best HMM Match : UQ_con (HMM E-Value=3.6e-15) Length = 243 Score = 37.9 bits (84), Expect = 0.003 Identities = 15/49 (30%), Positives = 28/49 (57%) Frame = +1 Query: 259 TRIYHPNINSNGSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPL 405 T+IYHPN++ +C+ +L W + + ++ + L +PN +DPL Sbjct: 75 TKIYHPNMDGYDGVCMSLL-DDWQASNDLEDLVQGLLFLFYNPNLEDPL 122 >SB_26178| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 897 Score = 33.1 bits (72), Expect = 0.098 Identities = 25/70 (35%), Positives = 32/70 (45%), Gaps = 8/70 (11%) Frame = +2 Query: 59 KRINRELQDLGRDPPAQCSAGPHGEDLFHWQA---TIMGPV----DSPYQGGVF-FLTIH 214 KR+ +E QD+ R SA ++LF W TI G D G F L I Sbjct: 737 KRLMKEFQDVSRKTERIFSAELVDDNLFEWNVKLHTIDGDSLLYRDMVETGSKFILLNIT 796 Query: 215 FPTDYPFKPP 244 FP ++PF PP Sbjct: 797 FPENFPFAPP 806 >SB_26761| Best HMM Match : UQ_con (HMM E-Value=1.7e-06) Length = 739 Score = 32.7 bits (71), Expect = 0.13 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +2 Query: 146 WQATIMGPVDSPYQGGVFFLTIHFPTDYPFKPP 244 ++ I GP +PY G+F I P +YP PP Sbjct: 636 FRVMIEGPAGTPYDHGLFAFDILLPANYPDAPP 668 >SB_4905| Best HMM Match : Mito_carr (HMM E-Value=3.3e-13) Length = 577 Score = 29.9 bits (64), Expect = 0.91 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = -2 Query: 406 PKGRLGWDRIEVSRLRATLWIW*ALVTTVHAECQDRW 296 P RL W+R+E+SR+ LW W V + Q W Sbjct: 166 PLFRLHWNRVEMSRVMVFLW-WIKFALRVSMQKQINW 201 >SB_26293| Best HMM Match : WD40 (HMM E-Value=1.1e-15) Length = 140 Score = 29.1 bits (62), Expect = 1.6 Identities = 14/35 (40%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = -2 Query: 202 EENSSLIRTVNWAHNCGLPMEQIFTV-WACRTLCW 101 E +S +R V WA N GLP I + CR + W Sbjct: 35 EAHSDWVRDVAWAPNVGLPTSTIASCSQDCRVIIW 69 >SB_43290| Best HMM Match : AMP-binding (HMM E-Value=6.5e-16) Length = 980 Score = 28.7 bits (61), Expect = 2.1 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = +2 Query: 131 EDLFHWQATIMGPVDSPYQGGVFFLTIHFPTDYP 232 E+ F W + ++ VDS + GGV+ L + P P Sbjct: 186 EESFQWMSHVLPAVDSIHSGGVYCLCLVPPGGLP 219 >SB_11967| Best HMM Match : Pollen_allerg_2 (HMM E-Value=1.7) Length = 1815 Score = 28.3 bits (60), Expect = 2.8 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +1 Query: 367 CSLLCDPNPDDPLVPKK 417 C + DPNP DP +P K Sbjct: 1311 CGTITDPNPKDPYIPDK 1327 >SB_35857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2680 Score = 27.9 bits (59), Expect = 3.7 Identities = 15/37 (40%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = -3 Query: 180 GLSTGPIIVACQWNRSS-PCGPAEHCAGGSLPRSCNS 73 GL + A WN S C P A GSL +CNS Sbjct: 803 GLRCDQCVSAYYWNPSGYGCSPCNCDASGSLATNCNS 839 >SB_33210| Best HMM Match : Spectrin (HMM E-Value=1.3e-12) Length = 186 Score = 27.9 bits (59), Expect = 3.7 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = +3 Query: 96 IHQHNVRQAHTVKICSIGKPQLWAQLTVLIKE 191 +H+ N + +++C QLW L VLIK+ Sbjct: 56 LHRENYHDSERIQVCKGRIIQLWELLLVLIKQ 87 >SB_5453| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2578 Score = 27.9 bits (59), Expect = 3.7 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = +1 Query: 250 CITTRIYHPNINSNGSICLDILRAQWSPALTISK 351 CI T + ++ N S LD+ +AQ+ AL+ K Sbjct: 2081 CIATEALNNHLRCNDSFVLDLFQAQYRSALSCPK 2114 >SB_292| Best HMM Match : HEAT (HMM E-Value=4.6e-29) Length = 1239 Score = 27.9 bits (59), Expect = 3.7 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = +1 Query: 328 SPALTISKVLLSICSLLCDPN 390 S +LTISK + IC LL DPN Sbjct: 116 SSSLTISKFVPHICKLLGDPN 136 >SB_24498| Best HMM Match : Galactosyl_T_2 (HMM E-Value=0) Length = 446 Score = 27.1 bits (57), Expect = 6.4 Identities = 9/19 (47%), Positives = 15/19 (78%) Frame = +1 Query: 322 QWSPALTISKVLLSICSLL 378 +WSP ++ K+LLS+ S+L Sbjct: 9 RWSPVQSVEKILLSVISML 27 >SB_9755| Best HMM Match : Sushi (HMM E-Value=0) Length = 1351 Score = 27.1 bits (57), Expect = 6.4 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = -3 Query: 312 NVKTDGTITVYVRMINTCCDATFGGLKG*SVGKCMVRKK 196 N DG++T Y I CD F L+G SV +C ++ Sbjct: 349 NGSKDGSLTFYPNKITFACDEGF-LLRGSSVRRCQSNRR 386 >SB_45371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 27.1 bits (57), Expect = 6.4 Identities = 14/38 (36%), Positives = 18/38 (47%) Frame = -2 Query: 403 KGRLGWDRIEVSRLRATLWIW*ALVTTVHAECQDRWNH 290 +GRL D S R T W+ +T + C DRW H Sbjct: 57 RGRLHSDEPSDSGERNTYWM--KQLTEFESSCTDRWGH 92 >SB_59018| Best HMM Match : Calx-beta (HMM E-Value=2.2) Length = 291 Score = 26.6 bits (56), Expect = 8.5 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = +1 Query: 190 RSFLPYHTFPYRLPFQTTKSCITTRI 267 R F+P F +P+ T SC T I Sbjct: 13 RDFIPLSNFTVTIPYGTNTSCFTVTI 38 >SB_45042| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 589 Score = 26.6 bits (56), Expect = 8.5 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = +1 Query: 325 WSPALTISKVLLSICSLLCDPNPDDPLVPK 414 W P + +S VLL++ L D D PK Sbjct: 244 WEPYMDVSSVLLALLELSADDKAHDMSFPK 273 >SB_1836| Best HMM Match : zf-C2H2 (HMM E-Value=0.0016) Length = 413 Score = 26.6 bits (56), Expect = 8.5 Identities = 15/46 (32%), Positives = 23/46 (50%) Frame = +1 Query: 244 KSCITTRIYHPNINSNGSICLDILRAQWSPALTISKVLLSICSLLC 381 K + I + N + N I I++ + LTI KV + I +LLC Sbjct: 355 KGMLPKFINNGNADGNVRISSVIMKEMYHELLTIVKVFIGIYALLC 400 >SB_57341| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 266 Score = 26.6 bits (56), Expect = 8.5 Identities = 19/52 (36%), Positives = 28/52 (53%), Gaps = 1/52 (1%) Frame = +3 Query: 216 SLQTTLSNHQKLHHNTYLS-S*HKQ*WFHLS*HSACTVVTSAHHIQSVALNL 368 SL TL + +K HH T LS + H+Q HL+ S HH+ S+++ L Sbjct: 84 SLSVTL-HREKQHHLTSLSVTLHRQKQDHLTSLSVTLHREKQHHLTSLSVTL 134 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,548,482 Number of Sequences: 59808 Number of extensions: 367468 Number of successful extensions: 941 Number of sequences better than 10.0: 36 Number of HSP's better than 10.0 without gapping: 819 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 932 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 801830705 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -