BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1074 (402 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_01_1025 + 8861153-8861376,8861929-8863027 27 5.6 10_08_0339 + 16922509-16923876,16923941-16924384,16924469-169246... 27 7.3 >07_01_1025 + 8861153-8861376,8861929-8863027 Length = 440 Score = 27.1 bits (57), Expect = 5.6 Identities = 15/57 (26%), Positives = 23/57 (40%) Frame = +1 Query: 220 HTCRWLLSNKEHLFIIERKTCLKILRRFHPTLCFVLFLNYVNIASKYLKTRVNISRT 390 HTC WL S L ++ C R P F L Y+N ++ T + ++ Sbjct: 27 HTCAWLASGFVLLALLHLLCCAPAGTR--PAAAFSPLLQYINNTYSFVSTVPGVGKS 81 >10_08_0339 + 16922509-16923876,16923941-16924384,16924469-16924655, 16924750-16925702 Length = 983 Score = 26.6 bits (56), Expect = 7.3 Identities = 10/25 (40%), Positives = 17/25 (68%) Frame = +1 Query: 235 LLSNKEHLFIIERKTCLKILRRFHP 309 L + E L ++ER++ +LRR+HP Sbjct: 476 LARDTEELAVVERRSFSPVLRRWHP 500 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,162,736 Number of Sequences: 37544 Number of extensions: 128380 Number of successful extensions: 243 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 237 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 243 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 694697784 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -