BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1073 (501 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_22342| Best HMM Match : No HMM Matches (HMM E-Value=.) 149 1e-36 SB_4971| Best HMM Match : Ras (HMM E-Value=0) 126 1e-29 SB_44625| Best HMM Match : Ras (HMM E-Value=0) 116 8e-27 SB_33745| Best HMM Match : Ras (HMM E-Value=2.5e-21) 111 4e-25 SB_32061| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 2e-23 SB_28695| Best HMM Match : Ras (HMM E-Value=0) 99 2e-21 SB_24842| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 7e-21 SB_13045| Best HMM Match : Ras (HMM E-Value=0) 93 1e-19 SB_27557| Best HMM Match : Ras (HMM E-Value=0) 93 2e-19 SB_10811| Best HMM Match : Ras (HMM E-Value=0) 90 8e-19 SB_7589| Best HMM Match : Ras (HMM E-Value=0) 89 3e-18 SB_36483| Best HMM Match : Ras (HMM E-Value=0) 88 3e-18 SB_17958| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 6e-18 SB_50855| Best HMM Match : Ras (HMM E-Value=0) 86 2e-17 SB_3743| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 4e-16 SB_50523| Best HMM Match : Ras (HMM E-Value=0) 81 7e-16 SB_24843| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 3e-14 SB_33743| Best HMM Match : Ras (HMM E-Value=2e-34) 74 8e-14 SB_8315| Best HMM Match : Ras (HMM E-Value=0) 72 3e-13 SB_58218| Best HMM Match : Ras (HMM E-Value=1.4013e-44) 71 4e-13 SB_48712| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 9e-13 SB_8803| Best HMM Match : Ras (HMM E-Value=7.9e-30) 69 3e-12 SB_34767| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_39864| Best HMM Match : Ras (HMM E-Value=1.6e-30) 61 4e-10 SB_39585| Best HMM Match : Ras (HMM E-Value=6e-35) 55 4e-08 SB_54971| Best HMM Match : Ras (HMM E-Value=0) 53 2e-07 SB_41076| Best HMM Match : Ras (HMM E-Value=1.90016e-42) 52 3e-07 SB_1645| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_39092| Best HMM Match : Arf (HMM E-Value=8e-36) 49 2e-06 SB_6223| Best HMM Match : Ras (HMM E-Value=0) 48 3e-06 SB_38511| Best HMM Match : Ras (HMM E-Value=1.2e-22) 47 8e-06 SB_5222| Best HMM Match : Ras (HMM E-Value=2.9e-09) 47 8e-06 SB_46477| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_53421| Best HMM Match : Arf (HMM E-Value=0) 46 1e-05 SB_36256| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_57342| Best HMM Match : Arf (HMM E-Value=0) 45 3e-05 SB_45967| Best HMM Match : Ras (HMM E-Value=2.1e-07) 45 3e-05 SB_37042| Best HMM Match : Arf (HMM E-Value=0) 45 4e-05 SB_11310| Best HMM Match : Arf (HMM E-Value=0) 45 4e-05 SB_53183| Best HMM Match : Ras (HMM E-Value=0) 44 5e-05 SB_4994| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 5e-05 SB_42281| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-05 SB_29253| Best HMM Match : Ras (HMM E-Value=2.8e-05) 44 7e-05 SB_22243| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-05 SB_288| Best HMM Match : Ras (HMM E-Value=1.5e-11) 44 7e-05 SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) 44 9e-05 SB_47462| Best HMM Match : Ras (HMM E-Value=0) 44 9e-05 SB_18671| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 1e-04 SB_56255| Best HMM Match : Arf (HMM E-Value=0) 43 1e-04 SB_56254| Best HMM Match : Arf (HMM E-Value=5.3e-31) 43 1e-04 SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) 43 1e-04 SB_17524| Best HMM Match : Ras (HMM E-Value=2.1e-10) 43 1e-04 SB_12680| Best HMM Match : Ras (HMM E-Value=3.4e-05) 42 2e-04 SB_39315| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_38326| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 5e-04 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 41 5e-04 SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_42884| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 9e-04 SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 9e-04 SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) 40 9e-04 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 9e-04 SB_11757| Best HMM Match : Ras (HMM E-Value=0) 40 0.001 SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 40 0.002 SB_12762| Best HMM Match : Ras (HMM E-Value=2.2e-21) 40 0.002 SB_8853| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_55976| Best HMM Match : zf-C3HC4 (HMM E-Value=0.087) 39 0.002 SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_51325| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_43938| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_42082| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87) 39 0.002 SB_36172| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_30147| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_26655| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_25292| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) 39 0.002 SB_21491| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_15561| Best HMM Match : Protamine_P2 (HMM E-Value=8.8) 39 0.002 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 39 0.002 SB_9600| Best HMM Match : DUF1596 (HMM E-Value=9.6) 39 0.002 SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_8545| Best HMM Match : C2 (HMM E-Value=0.00073) 39 0.002 SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_967| Best HMM Match : Calx-beta (HMM E-Value=2.8) 39 0.002 SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_56708| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) 39 0.002 SB_45805| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_45526| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_40500| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_39283| Best HMM Match : ADK (HMM E-Value=3.7) 39 0.002 SB_38562| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_18780| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 39 0.002 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_5183| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_7588| Best HMM Match : DcpS (HMM E-Value=0) 38 0.005 SB_11841| Best HMM Match : Ras (HMM E-Value=0) 38 0.006 SB_43575| Best HMM Match : Sina (HMM E-Value=0) 38 0.006 SB_58217| Best HMM Match : Ras (HMM E-Value=0.00048) 37 0.008 SB_22528| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.011 SB_6793| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.014 SB_6284| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.019 SB_56256| Best HMM Match : Ras (HMM E-Value=8.9e-31) 36 0.025 SB_52002| Best HMM Match : Ras (HMM E-Value=2.3e-19) 34 0.057 SB_18358| Best HMM Match : Arf (HMM E-Value=0) 34 0.076 SB_58700| Best HMM Match : Ras (HMM E-Value=2.7e-15) 33 0.17 SB_53792| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.31 SB_49252| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.31 SB_32162| Best HMM Match : Ras (HMM E-Value=4.7e-31) 32 0.31 SB_25972| Best HMM Match : MIF4G (HMM E-Value=4.9e-40) 31 0.40 SB_54000| Best HMM Match : MMR_HSR1 (HMM E-Value=1.8) 31 0.40 SB_45519| Best HMM Match : RNB (HMM E-Value=1.6e-35) 31 0.40 SB_2880| Best HMM Match : Ras (HMM E-Value=3.2e-17) 31 0.53 SB_24444| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.71 SB_31439| Best HMM Match : Ras (HMM E-Value=4.7) 31 0.71 SB_15207| Best HMM Match : Arf (HMM E-Value=1.9e-05) 30 1.2 SB_1071| Best HMM Match : Ras (HMM E-Value=0) 30 1.2 SB_32972| Best HMM Match : Arf (HMM E-Value=2.66247e-44) 29 1.6 SB_31629| Best HMM Match : DEAD (HMM E-Value=1.2e-05) 29 1.6 SB_214| Best HMM Match : Arf (HMM E-Value=0) 29 1.6 SB_39298| Best HMM Match : Ras (HMM E-Value=0.11) 29 2.2 SB_12958| Best HMM Match : Ras (HMM E-Value=6e-13) 29 2.2 SB_19218| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8 SB_47450| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.0 SB_24106| Best HMM Match : Ras (HMM E-Value=1e-35) 28 5.0 SB_38097| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_51788| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_35038| Best HMM Match : Ras (HMM E-Value=6.8e-13) 27 8.7 >SB_22342| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 778 Score = 149 bits (361), Expect = 1e-36 Identities = 67/76 (88%), Positives = 72/76 (94%) Frame = +2 Query: 269 DDTYTESYISTIGVDFKIRTVDLNGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIIVYD 448 DDTYTESYISTIGVDFKIRT++L+GKTIKLQIWDTAGQERFRTITSSYYRGAHGII+VYD Sbjct: 51 DDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYD 110 Query: 449 CTDQDSFNTVKQWF*E 496 TDQ+SFN VKQW E Sbjct: 111 VTDQESFNNVKQWLQE 126 Score = 51.2 bits (117), Expect = 5e-07 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = +3 Query: 189 PEYDYLFKLLLIGDSGVGKSCL 254 PEYDYLFKLLLIGDSGVGKSCL Sbjct: 3 PEYDYLFKLLLIGDSGVGKSCL 24 >SB_4971| Best HMM Match : Ras (HMM E-Value=0) Length = 209 Score = 126 bits (304), Expect = 1e-29 Identities = 53/81 (65%), Positives = 70/81 (86%) Frame = +2 Query: 254 VLRFADDTYTESYISTIGVDFKIRTVDLNGKTIKLQIWDTAGQERFRTITSSYYRGAHGI 433 +LRFADDT++ +YISTIGVDFKIRT+ ++GKTIKLQIWDTAGQERFRT+T++YYR AHGI Sbjct: 25 LLRFADDTFSNTYISTIGVDFKIRTLTVDGKTIKLQIWDTAGQERFRTLTTAYYRSAHGI 84 Query: 434 IIVYDCTDQDSFNTVKQWF*E 496 +++YD + ++F + QW E Sbjct: 85 VLIYDVNESETFLHLSQWLEE 105 Score = 44.4 bits (100), Expect = 5e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 192 EYDYLFKLLLIGDSGVGKSCL 254 EYDYLFKLLLIGDSGVGKS L Sbjct: 4 EYDYLFKLLLIGDSGVGKSSL 24 >SB_44625| Best HMM Match : Ras (HMM E-Value=0) Length = 128 Score = 116 bits (280), Expect = 8e-27 Identities = 49/73 (67%), Positives = 63/73 (86%) Frame = +2 Query: 278 YTESYISTIGVDFKIRTVDLNGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIIVYDCTD 457 ++ SYI+TIGVDFKIRT++++G+ +KLQIWDTAGQERFRTITS+YYRG HG+I+VYD T Sbjct: 2 FSGSYITTIGVDFKIRTINIDGEKVKLQIWDTAGQERFRTITSTYYRGTHGVIVVYDVTS 61 Query: 458 QDSFNTVKQWF*E 496 D+F VK+W E Sbjct: 62 ADTFVNVKRWLHE 74 >SB_33745| Best HMM Match : Ras (HMM E-Value=2.5e-21) Length = 115 Score = 111 bits (266), Expect = 4e-25 Identities = 44/76 (57%), Positives = 65/76 (85%) Frame = +2 Query: 254 VLRFADDTYTESYISTIGVDFKIRTVDLNGKTIKLQIWDTAGQERFRTITSSYYRGAHGI 433 + R+ADD++T +++ST+G+DFK++TV N K +KLQIWDTAGQER+RTIT++YYRGA G Sbjct: 38 LFRYADDSFTSAFVSTVGIDFKVKTVFRNDKRVKLQIWDTAGQERYRTITTAYYRGAMGF 97 Query: 434 IIVYDCTDQDSFNTVK 481 I++YD T+++SF V+ Sbjct: 98 ILMYDITNEESFQAVQ 113 Score = 32.3 bits (70), Expect = 0.23 Identities = 12/18 (66%), Positives = 17/18 (94%) Frame = +3 Query: 195 YDYLFKLLLIGDSGVGKS 248 +DY+FKLL+IG+S VGK+ Sbjct: 18 FDYMFKLLIIGNSAVGKT 35 >SB_32061| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 919 Score = 105 bits (252), Expect = 2e-23 Identities = 44/81 (54%), Positives = 61/81 (75%) Frame = +2 Query: 254 VLRFADDTYTESYISTIGVDFKIRTVDLNGKTIKLQIWDTAGQERFRTITSSYYRGAHGI 433 +LRF DDT+ +TIGVDFK++T+ + G KL IWDTAGQERFRT+T SYYRGA G+ Sbjct: 25 LLRFTDDTFDPDIGATIGVDFKVKTLTVEGNKAKLAIWDTAGQERFRTLTPSYYRGAQGV 84 Query: 434 IIVYDCTDQDSFNTVKQWF*E 496 I+VYD +++F+ +++W E Sbjct: 85 ILVYDTNSRETFDKLEEWLNE 105 >SB_28695| Best HMM Match : Ras (HMM E-Value=0) Length = 1058 Score = 99.1 bits (236), Expect = 2e-21 Identities = 41/76 (53%), Positives = 58/76 (76%) Frame = +2 Query: 260 RFADDTYTESYISTIGVDFKIRTVDLNGKTIKLQIWDTAGQERFRTITSSYYRGAHGIII 439 RF D + S+ +TIGVDF+I+T+++NG+ I +Q+WDTAGQERFR+IT Y+R A GI+I Sbjct: 915 RFCHDQWKPSFTATIGVDFQIKTMNVNGQCIAIQLWDTAGQERFRSITKQYFRKADGILI 974 Query: 440 VYDCTDQDSFNTVKQW 487 YD T + SF +K+W Sbjct: 975 FYDVTAESSFTNLKKW 990 Score = 27.9 bits (59), Expect = 5.0 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = +3 Query: 204 LFKLLLIGDSGVGKS 248 +FK++ IGDSGVGKS Sbjct: 896 VFKVVFIGDSGVGKS 910 >SB_24842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 97.1 bits (231), Expect = 7e-21 Identities = 42/78 (53%), Positives = 57/78 (73%) Frame = +2 Query: 254 VLRFADDTYTESYISTIGVDFKIRTVDLNGKTIKLQIWDTAGQERFRTITSSYYRGAHGI 433 V +F + + TIGVDF I+TVD++G+ +KLQIWDTAGQERFR+IT SYY A G+ Sbjct: 24 VRQFTKGYFPPNQGPTIGVDFTIKTVDVDGEKVKLQIWDTAGQERFRSITQSYYHNADGV 83 Query: 434 IIVYDCTDQDSFNTVKQW 487 I+ YD T++ SF ++ QW Sbjct: 84 IVTYDITNKKSFESLPQW 101 Score = 37.9 bits (84), Expect = 0.005 Identities = 13/21 (61%), Positives = 19/21 (90%) Frame = +3 Query: 192 EYDYLFKLLLIGDSGVGKSCL 254 +Y YLFK++L+GD+ VGK+CL Sbjct: 3 DYSYLFKIILVGDANVGKTCL 23 >SB_13045| Best HMM Match : Ras (HMM E-Value=0) Length = 629 Score = 93.1 bits (221), Expect = 1e-19 Identities = 41/79 (51%), Positives = 55/79 (69%) Frame = +2 Query: 260 RFADDTYTESYISTIGVDFKIRTVDLNGKTIKLQIWDTAGQERFRTITSSYYRGAHGIII 439 RF + + STIGV+F R++ + GK IK Q+WDTAGQER+R ITS+YYRGA G ++ Sbjct: 31 RFTRNEFDIESKSTIGVEFATRSIQVEGKIIKAQVWDTAGQERYRAITSAYYRGAVGAVL 90 Query: 440 VYDCTDQDSFNTVKQWF*E 496 VYD T Q +F V++W E Sbjct: 91 VYDLTKQKTFQDVERWLLE 109 Score = 39.1 bits (87), Expect = 0.002 Identities = 16/20 (80%), Positives = 19/20 (95%) Frame = +3 Query: 195 YDYLFKLLLIGDSGVGKSCL 254 YDYL+K++LIGDSGVGKS L Sbjct: 9 YDYLYKIVLIGDSGVGKSSL 28 >SB_27557| Best HMM Match : Ras (HMM E-Value=0) Length = 184 Score = 92.7 bits (220), Expect = 2e-19 Identities = 45/84 (53%), Positives = 59/84 (70%), Gaps = 2/84 (2%) Frame = +2 Query: 251 SVLR-FADDTYTESYISTIGVDFKIRTVDLNGKT-IKLQIWDTAGQERFRTITSSYYRGA 424 S+LR F + + E+ T+GVDF +R ++L G IKLQIWDTAGQERFR+IT SYYR Sbjct: 28 SLLRQFTEGQFFENSDPTVGVDFHVRVLELKGDVRIKLQIWDTAGQERFRSITYSYYRNT 87 Query: 425 HGIIIVYDCTDQDSFNTVKQWF*E 496 G +I+YD T++DSF V W+ E Sbjct: 88 VGCLIIYDITNRDSFVNVMDWYKE 111 Score = 33.5 bits (73), Expect = 0.10 Identities = 14/22 (63%), Positives = 18/22 (81%) Frame = +3 Query: 189 PEYDYLFKLLLIGDSGVGKSCL 254 P+Y Y F+++LIGDS VGKS L Sbjct: 8 PKYFYQFRIILIGDSTVGKSSL 29 >SB_10811| Best HMM Match : Ras (HMM E-Value=0) Length = 304 Score = 90.2 bits (214), Expect = 8e-19 Identities = 36/63 (57%), Positives = 52/63 (82%) Frame = +2 Query: 299 TIGVDFKIRTVDLNGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIIVYDCTDQDSFNTV 478 TIGV+F + V++ GK++KLQIWDTAGQERFR++T SYYRGA G ++VYD + +++FN++ Sbjct: 127 TIGVEFGSKIVNVGGKSVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDISSRETFNSL 186 Query: 479 KQW 487 W Sbjct: 187 TNW 189 >SB_7589| Best HMM Match : Ras (HMM E-Value=0) Length = 640 Score = 88.6 bits (210), Expect = 3e-18 Identities = 37/78 (47%), Positives = 57/78 (73%) Frame = +2 Query: 254 VLRFADDTYTESYISTIGVDFKIRTVDLNGKTIKLQIWDTAGQERFRTITSSYYRGAHGI 433 +LR + + + ST+GVDF+++T+ ++GKT LQ+WDTAGQERFR+I SY+R A G+ Sbjct: 459 ILRLCRNRFHSALNSTLGVDFQMKTLVVDGKTYALQLWDTAGQERFRSIAKSYFRKADGV 518 Query: 434 IIVYDCTDQDSFNTVKQW 487 +++YD T + SF V+ W Sbjct: 519 LLLYDVTCETSFLDVRDW 536 >SB_36483| Best HMM Match : Ras (HMM E-Value=0) Length = 213 Score = 88.2 bits (209), Expect = 3e-18 Identities = 34/79 (43%), Positives = 59/79 (74%) Frame = +2 Query: 254 VLRFADDTYTESYISTIGVDFKIRTVDLNGKTIKLQIWDTAGQERFRTITSSYYRGAHGI 433 + RF DD + +TIGVDF I DL+GK +KLQ+WDTAG+E++R ++ S++RGA G Sbjct: 27 IRRFHDDEFNAQLCTTIGVDFFIHDFDLDGKKVKLQLWDTAGEEKYRALSRSFFRGADGA 86 Query: 434 IIVYDCTDQDSFNTVKQWF 490 ++V+D + ++SF++++ ++ Sbjct: 87 LLVFDVSVKESFDSIRDYW 105 Score = 30.7 bits (66), Expect = 0.71 Identities = 12/19 (63%), Positives = 16/19 (84%) Frame = +3 Query: 198 DYLFKLLLIGDSGVGKSCL 254 DY+FK+L++GD VGKS L Sbjct: 8 DYVFKVLVLGDCNVGKSSL 26 >SB_17958| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 271 Score = 87.4 bits (207), Expect = 6e-18 Identities = 36/78 (46%), Positives = 54/78 (69%) Frame = +2 Query: 254 VLRFADDTYTESYISTIGVDFKIRTVDLNGKTIKLQIWDTAGQERFRTITSSYYRGAHGI 433 + RF + ++ ST+GVD R +D++G +KLQ WDTAGQE+FR IT SYYR A + Sbjct: 28 IRRFTKGYFCDNSSSTVGVDVGTRVLDIHGDRVKLQCWDTAGQEKFRGITQSYYRNADAV 87 Query: 434 IIVYDCTDQDSFNTVKQW 487 I+V+D T++ +F ++ QW Sbjct: 88 ILVFDITNRGTFASIPQW 105 Score = 28.7 bits (61), Expect = 2.8 Identities = 11/18 (61%), Positives = 15/18 (83%) Frame = +3 Query: 201 YLFKLLLIGDSGVGKSCL 254 Y FK+L++GD GVGK+ L Sbjct: 10 YSFKVLVVGDPGVGKTSL 27 >SB_50855| Best HMM Match : Ras (HMM E-Value=0) Length = 733 Score = 85.8 bits (203), Expect = 2e-17 Identities = 39/78 (50%), Positives = 50/78 (64%) Frame = +2 Query: 254 VLRFADDTYTESYISTIGVDFKIRTVDLNGKTIKLQIWDTAGQERFRTITSSYYRGAHGI 433 VLRF + E STIG F +TV L+ T+K +IWDTAGQER+ ++ YYRGA Sbjct: 38 VLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAA 97 Query: 434 IIVYDCTDQDSFNTVKQW 487 I+VYD T+QD+F K W Sbjct: 98 IVVYDITNQDTFARAKTW 115 >SB_3743| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 365 Score = 81.4 bits (192), Expect = 4e-16 Identities = 37/76 (48%), Positives = 49/76 (64%) Frame = +2 Query: 260 RFADDTYTESYISTIGVDFKIRTVDLNGKTIKLQIWDTAGQERFRTITSSYYRGAHGIII 439 RF D + E Y TIG+DF +TV L+ ++LQIWDTAGQERFR + SY R + +I Sbjct: 182 RFIYDIFEEKYQPTIGIDFMTKTVLLDDFEVRLQIWDTAGQERFRCLIHSYIRDSEAALI 241 Query: 440 VYDCTDQDSFNTVKQW 487 V+D T+ SF +V W Sbjct: 242 VFDITNYTSFESVGDW 257 >SB_50523| Best HMM Match : Ras (HMM E-Value=0) Length = 154 Score = 80.6 bits (190), Expect = 7e-16 Identities = 33/49 (67%), Positives = 42/49 (85%) Frame = +2 Query: 341 GKTIKLQIWDTAGQERFRTITSSYYRGAHGIIIVYDCTDQDSFNTVKQW 487 GK IKLQIWDTAGQERF TIT++YYRGA GI++VYD T++ SF+ + +W Sbjct: 2 GKKIKLQIWDTAGQERFHTITTAYYRGAMGIMLVYDVTNEKSFSNISKW 50 >SB_24843| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 265 Score = 75.4 bits (177), Expect = 3e-14 Identities = 34/80 (42%), Positives = 51/80 (63%), Gaps = 1/80 (1%) Frame = +2 Query: 260 RFADDTYTESYISTIGVDFKIRTVDLNGKTIKLQIWDTAGQERFR-TITSSYYRGAHGII 436 R + E +TIGVDF ++++LNG+ +KLQ+WDTAGQERFR ++ YYR + ++ Sbjct: 65 RLCTGKFPERTETTIGVDFWEKSLELNGEFVKLQLWDTAGQERFRKSMVCHYYRNVNAVV 124 Query: 437 IVYDCTDQDSFNTVKQWF*E 496 +YD T + SF + W E Sbjct: 125 FMYDITRKCSFEALTTWIVE 144 Score = 30.7 bits (66), Expect = 0.71 Identities = 11/16 (68%), Positives = 15/16 (93%) Frame = +3 Query: 207 FKLLLIGDSGVGKSCL 254 FK+++IGDS VGK+CL Sbjct: 47 FKIIIIGDSNVGKTCL 62 >SB_33743| Best HMM Match : Ras (HMM E-Value=2e-34) Length = 241 Score = 73.7 bits (173), Expect = 8e-14 Identities = 31/46 (67%), Positives = 36/46 (78%) Frame = +2 Query: 350 IKLQIWDTAGQERFRTITSSYYRGAHGIIIVYDCTDQDSFNTVKQW 487 +KLQIWDTAGQERFRTIT SYYR +G+II YD T D+F V +W Sbjct: 95 VKLQIWDTAGQERFRTITQSYYRSCNGVIIAYDITKCDTFKNVIRW 140 >SB_8315| Best HMM Match : Ras (HMM E-Value=0) Length = 565 Score = 71.7 bits (168), Expect = 3e-13 Identities = 33/87 (37%), Positives = 55/87 (63%), Gaps = 11/87 (12%) Frame = +2 Query: 260 RFADDTYTESYISTIGVDFKIRTV---DLN--------GKTIKLQIWDTAGQERFRTITS 406 ++ D + ++ TIG+DF+ + V LN G+ I LQ+WDTAGQERFR++T+ Sbjct: 125 QYTDSHFNPRFVPTIGIDFREKRVVHHPLNPDGERSTRGQRIHLQLWDTAGQERFRSLTT 184 Query: 407 SYYRGAHGIIIVYDCTDQDSFNTVKQW 487 +++R A G ++V+D T + SF ++ W Sbjct: 185 AFFRDAMGFLLVFDLTHEQSFVNIRNW 211 Score = 28.3 bits (60), Expect = 3.8 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = +3 Query: 198 DYLFKLLLIGDSGVGKSCL 254 ++L K L +GDSGVGK+ L Sbjct: 104 EFLIKFLALGDSGVGKTSL 122 >SB_58218| Best HMM Match : Ras (HMM E-Value=1.4013e-44) Length = 212 Score = 71.3 bits (167), Expect = 4e-13 Identities = 30/76 (39%), Positives = 46/76 (60%) Frame = +2 Query: 260 RFADDTYTESYISTIGVDFKIRTVDLNGKTIKLQIWDTAGQERFRTITSSYYRGAHGIII 439 R ++ +T +TIG+D + V + K + L +WDTAG ERFRT+T +YYRGAH I+ Sbjct: 30 RLKENHFTPGRRNTIGIDSCSKFVKIGEKQVTLSVWDTAGVERFRTVTKNYYRGAHACIL 89 Query: 440 VYDCTDQDSFNTVKQW 487 +++ D S + W Sbjct: 90 MFNVDDPGSLQYLLHW 105 Score = 27.1 bits (57), Expect = 8.7 Identities = 10/17 (58%), Positives = 16/17 (94%) Frame = +3 Query: 204 LFKLLLIGDSGVGKSCL 254 LFK++L+G++GVGK+ L Sbjct: 11 LFKVVLLGEAGVGKTSL 27 >SB_48712| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 410 Score = 70.1 bits (164), Expect = 9e-13 Identities = 31/76 (40%), Positives = 46/76 (60%) Frame = +2 Query: 260 RFADDTYTESYISTIGVDFKIRTVDLNGKTIKLQIWDTAGQERFRTITSSYYRGAHGIII 439 RF + TIGV+F + V L+G++ LQIWDTAGQERF+++ + +YRG+ ++ Sbjct: 230 RFVCGKFDTQSFHTIGVEFLNKDVKLDGESYTLQIWDTAGQERFKSLRTPFYRGSDLCLL 289 Query: 440 VYDCTDQDSFNTVKQW 487 VY D SF + W Sbjct: 290 VYAVDDAKSFTNLSMW 305 >SB_8803| Best HMM Match : Ras (HMM E-Value=7.9e-30) Length = 517 Score = 68.5 bits (160), Expect = 3e-12 Identities = 29/44 (65%), Positives = 37/44 (84%) Frame = +2 Query: 365 WDTAGQERFRTITSSYYRGAHGIIIVYDCTDQDSFNTVKQWF*E 496 W+ AGQERFRTITSSYYRGAHG++IVYD T ++S+N + +W E Sbjct: 374 WE-AGQERFRTITSSYYRGAHGVMIVYDITKRESYNNLHKWLME 416 >SB_34767| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 65.7 bits (153), Expect = 2e-11 Identities = 30/79 (37%), Positives = 48/79 (60%), Gaps = 1/79 (1%) Frame = +2 Query: 254 VLRFADDTYTESYISTIGVDFKIRTVD-LNGKTIKLQIWDTAGQERFRTITSSYYRGAHG 430 V R+ ++ + Y TIGVDF ++T+ TI+LQIW AGQERF ++T YY+GA Sbjct: 35 VKRYVNNIWHPLYKPTIGVDFALKTIQWAQNTTIRLQIWLIAGQERFSSMTRVYYKGADA 94 Query: 431 IIIVYDCTDQDSFNTVKQW 487 ++++D Q + + +W Sbjct: 95 CVVLFDLERQTTLDGAIKW 113 >SB_39864| Best HMM Match : Ras (HMM E-Value=1.6e-30) Length = 421 Score = 61.3 bits (142), Expect = 4e-10 Identities = 25/54 (46%), Positives = 36/54 (66%) Frame = +2 Query: 335 LNGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIIVYDCTDQDSFNTVKQWF*E 496 +N K K IWDTAGQERF+++ YYR A I+VYD T + +F++++ W E Sbjct: 4 VNDKAYKFNIWDTAGQERFKSLAPLYYRDAAAAILVYDITIESTFHSLRPWIRE 57 >SB_39585| Best HMM Match : Ras (HMM E-Value=6e-35) Length = 145 Score = 54.8 bits (126), Expect = 4e-08 Identities = 21/42 (50%), Positives = 31/42 (73%) Frame = +2 Query: 362 IWDTAGQERFRTITSSYYRGAHGIIIVYDCTDQDSFNTVKQW 487 IWDTAGQERF+++ ++YRGA ++V+D T +SF T+ W Sbjct: 1 IWDTAGQERFQSLGVAFYRGADCCVLVFDVTQPNSFKTLDSW 42 >SB_54971| Best HMM Match : Ras (HMM E-Value=0) Length = 239 Score = 52.8 bits (121), Expect = 2e-07 Identities = 25/78 (32%), Positives = 39/78 (50%) Frame = +2 Query: 254 VLRFADDTYTESYISTIGVDFKIRTVDLNGKTIKLQIWDTAGQERFRTITSSYYRGAHGI 433 V R + + YI+T+GV+ + IK +WDTAGQE+F + YY Sbjct: 49 VKRHLTGEFEKKYIATLGVEVHPLIFFTSRGPIKFNVWDTAGQEKFGGLRDGYYIQGQCA 108 Query: 434 IIVYDCTDQDSFNTVKQW 487 II++D T + ++ V W Sbjct: 109 IIMFDVTSRVTYKNVPNW 126 >SB_41076| Best HMM Match : Ras (HMM E-Value=1.90016e-42) Length = 704 Score = 52.0 bits (119), Expect = 3e-07 Identities = 22/50 (44%), Positives = 34/50 (68%) Frame = +2 Query: 338 NGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIIVYDCTDQDSFNTVKQW 487 + K IKL I DTAGQER+ +I +Y+RG G+ +V+D T + +F + +W Sbjct: 397 DNKKIKLTIGDTAGQERYFSILPAYFRGVQGVFLVFDITVEITFLQLHRW 446 Score = 39.5 bits (88), Expect = 0.002 Identities = 16/22 (72%), Positives = 19/22 (86%) Frame = +3 Query: 189 PEYDYLFKLLLIGDSGVGKSCL 254 P +DY FK L+IG+SGVGKSCL Sbjct: 345 PNWDYEFKTLIIGNSGVGKSCL 366 >SB_1645| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 244 Score = 49.6 bits (113), Expect = 1e-06 Identities = 23/71 (32%), Positives = 37/71 (52%), Gaps = 5/71 (7%) Frame = +2 Query: 299 TIGVDFKIRTVDLN-----GKTIKLQIWDTAGQERFRTITSSYYRGAHGIIIVYDCTDQD 463 TIG +++ D GKT L+ WD G S +Y G +G+I+V+D T++ Sbjct: 38 TIGCTVEVKLYDYKEGMPGGKTFFLEFWDIGGSANHENSRSIFYNGINGLILVHDLTNRK 97 Query: 464 SFNTVKQWF*E 496 SF +++W E Sbjct: 98 SFTNLRKWLAE 108 >SB_39092| Best HMM Match : Arf (HMM E-Value=8e-36) Length = 260 Score = 48.8 bits (111), Expect = 2e-06 Identities = 26/72 (36%), Positives = 36/72 (50%) Frame = +2 Query: 266 ADDTYTESYISTIGVDFKIRTVDLNGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIIVY 445 A ++E I T+G F +R V TIK +WD GQ RFR++ Y RG + I+ + Sbjct: 41 ASGQFSEDMIPTVG--FNMRKVSKGNVTIK--VWDIGGQPRFRSMWERYCRGVNCIVYMV 96 Query: 446 DCTDQDSFNTVK 481 D D D K Sbjct: 97 DAADHDKLEASK 108 >SB_6223| Best HMM Match : Ras (HMM E-Value=0) Length = 1665 Score = 48.4 bits (110), Expect = 3e-06 Identities = 22/78 (28%), Positives = 40/78 (51%) Frame = +2 Query: 257 LRFADDTYTESYISTIGVDFKIRTVDLNGKTIKLQIWDTAGQERFRTITSSYYRGAHGII 436 ++F + Y TI ++ + V ++ + L I DTAGQE F + Y R G + Sbjct: 29 IQFIQSHFVSDYDPTIEDSYRKQCV-IDERVAHLDILDTAGQEEFSAMREQYMRSGEGFL 87 Query: 437 IVYDCTDQDSFNTVKQWF 490 +V+ TD+ SF + +++ Sbjct: 88 LVFSVTDRSSFEEINKFY 105 >SB_38511| Best HMM Match : Ras (HMM E-Value=1.2e-22) Length = 159 Score = 47.2 bits (107), Expect = 8e-06 Identities = 19/36 (52%), Positives = 25/36 (69%) Frame = +2 Query: 380 QERFRTITSSYYRGAHGIIIVYDCTDQDSFNTVKQW 487 QER+R ITS+YYRGA G ++VYD SF + +W Sbjct: 2 QERYRAITSAYYRGAMGAVLVYDIAKGTSFMNLNKW 37 >SB_5222| Best HMM Match : Ras (HMM E-Value=2.9e-09) Length = 181 Score = 47.2 bits (107), Expect = 8e-06 Identities = 19/36 (52%), Positives = 25/36 (69%) Frame = +2 Query: 380 QERFRTITSSYYRGAHGIIIVYDCTDQDSFNTVKQW 487 QER+R ITS+YYRGA G ++VYD SF + +W Sbjct: 2 QERYRAITSAYYRGAMGAVLVYDIAKGTSFMNLNKW 37 >SB_46477| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 6116 Score = 46.4 bits (105), Expect = 1e-05 Identities = 21/76 (27%), Positives = 42/76 (55%), Gaps = 1/76 (1%) Frame = +2 Query: 263 FADDTYTESYISTIGVDFKIRTVDLNGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIIV 442 F+ D + E Y+ T+ ++ + ++++GK ++L +WDTAGQE + + Y I++ Sbjct: 5949 FSKDQFPEVYVPTVFENY-VADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMC 6007 Query: 443 YDCTDQDSF-NTVKQW 487 + DS N ++W Sbjct: 6008 FSIDSPDSLENIPEKW 6023 >SB_53421| Best HMM Match : Arf (HMM E-Value=0) Length = 625 Score = 46.4 bits (105), Expect = 1e-05 Identities = 22/61 (36%), Positives = 33/61 (54%), Gaps = 1/61 (1%) Frame = +2 Query: 284 ESYISTIG-VDFKIRTVDLNGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIIVYDCTDQ 460 E +ST+ + F + TV K I +WD GQ++ R + YY+G GII V D D+ Sbjct: 19 EEVVSTVPTLGFNVETVTY--KNISFTVWDIGGQDKIRALWRVYYQGCQGIIFVVDSADR 76 Query: 461 D 463 + Sbjct: 77 E 77 >SB_36256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 45.6 bits (103), Expect = 2e-05 Identities = 20/33 (60%), Positives = 23/33 (69%) Frame = +3 Query: 15 AVAAALELVDPPGCRNSAAADPFFSLFSTRNKE 113 AVAAALELVDPPGCRNS A ++S N + Sbjct: 8 AVAAALELVDPPGCRNSMVASELMEIYSMYNND 40 >SB_57342| Best HMM Match : Arf (HMM E-Value=0) Length = 457 Score = 45.2 bits (102), Expect = 3e-05 Identities = 20/59 (33%), Positives = 32/59 (54%) Frame = +2 Query: 308 VDFKIRTVDLNGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIIVYDCTDQDSFNTVKQ 484 V F + T+ K I +WD GQ++ R + Y++GA GII V D D++ V++ Sbjct: 141 VAFNVETIS-PCKNITFSVWDIGGQDKIRRLWRHYFQGAEGIIFVVDSADKERIFEVRE 198 >SB_45967| Best HMM Match : Ras (HMM E-Value=2.1e-07) Length = 92 Score = 45.2 bits (102), Expect = 3e-05 Identities = 22/66 (33%), Positives = 35/66 (53%) Frame = +2 Query: 257 LRFADDTYTESYISTIGVDFKIRTVDLNGKTIKLQIWDTAGQERFRTITSSYYRGAHGII 436 ++F + + +SY TI F + + G+ L++ DTAGQ+ + SY G HG I Sbjct: 24 IQFVEGQFVDSYDPTIENTFT-KNIKYKGQEFFLELVDTAGQDEYSIFPQSYSMGIHGYI 82 Query: 437 IVYDCT 454 +VY T Sbjct: 83 LVYAVT 88 >SB_37042| Best HMM Match : Arf (HMM E-Value=0) Length = 188 Score = 44.8 bits (101), Expect = 4e-05 Identities = 22/59 (37%), Positives = 33/59 (55%) Frame = +2 Query: 281 TESYISTIGVDFKIRTVDLNGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIIVYDCTD 457 T S I TIG F + T+ K + L IWD GQ++ R + Y++G G++ V D +D Sbjct: 44 TVSTIPTIG--FNVETLQPT-KNVTLTIWDVGGQDKIRPLWRHYFQGTEGLLFVVDSSD 99 >SB_11310| Best HMM Match : Arf (HMM E-Value=0) Length = 255 Score = 44.8 bits (101), Expect = 4e-05 Identities = 22/64 (34%), Positives = 33/64 (51%) Frame = +2 Query: 293 ISTIGVDFKIRTVDLNGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIIVYDCTDQDSFN 472 I TIG F + V+ K IK +WD GQ++ R + Y++ G+I V D D+D Sbjct: 119 IPTIG--FNVEVVEY--KNIKFTVWDIGGQDKIRLLWRLYFQETQGLIFVVDSNDRDRIQ 174 Query: 473 TVKQ 484 K+ Sbjct: 175 EAKE 178 >SB_53183| Best HMM Match : Ras (HMM E-Value=0) Length = 834 Score = 44.4 bits (100), Expect = 5e-05 Identities = 18/20 (90%), Positives = 20/20 (100%) Frame = +3 Query: 195 YDYLFKLLLIGDSGVGKSCL 254 YDYLFKLLLIGDSGVGK+C+ Sbjct: 6 YDYLFKLLLIGDSGVGKTCI 25 Score = 29.1 bits (62), Expect = 2.2 Identities = 9/22 (40%), Positives = 16/22 (72%) Frame = +2 Query: 422 AHGIIIVYDCTDQDSFNTVKQW 487 A GI++VYD T + +F+ + +W Sbjct: 125 AEGIMLVYDITQEKTFDNISKW 146 >SB_4994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 44.4 bits (100), Expect = 5e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 15 AVAAALELVDPPGCRNSAAAD 77 AVAAALELVDPPGCRNS AAD Sbjct: 8 AVAAALELVDPPGCRNSIAAD 28 >SB_42281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 44.0 bits (99), Expect = 7e-05 Identities = 21/64 (32%), Positives = 34/64 (53%) Frame = +2 Query: 293 ISTIGVDFKIRTVDLNGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIIVYDCTDQDSFN 472 I TIG F + +V+ K I +WD GQ++ R + Y++ G+I V D D++ N Sbjct: 46 IPTIG--FNVESVEY--KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIYVVDSNDRERVN 101 Query: 473 TVKQ 484 K+ Sbjct: 102 ESKE 105 >SB_29253| Best HMM Match : Ras (HMM E-Value=2.8e-05) Length = 68 Score = 44.0 bits (99), Expect = 7e-05 Identities = 19/38 (50%), Positives = 26/38 (68%) Frame = +2 Query: 260 RFADDTYTESYISTIGVDFKIRTVDLNGKTIKLQIWDT 373 RF + + STIGV+F R++ ++GKTIK QIWDT Sbjct: 30 RFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDT 67 Score = 41.1 bits (92), Expect = 5e-04 Identities = 18/21 (85%), Positives = 20/21 (95%) Frame = +3 Query: 192 EYDYLFKLLLIGDSGVGKSCL 254 EYDYLFK++LIGDSGVGKS L Sbjct: 7 EYDYLFKVVLIGDSGVGKSNL 27 >SB_22243| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 44.0 bits (99), Expect = 7e-05 Identities = 17/27 (62%), Positives = 21/27 (77%) Frame = +2 Query: 338 NGKTIKLQIWDTAGQERFRTITSSYYR 418 NG+ I+L +WDTAGQE F IT +YYR Sbjct: 30 NGEDIRLMLWDTAGQEEFDAITKAYYR 56 >SB_288| Best HMM Match : Ras (HMM E-Value=1.5e-11) Length = 220 Score = 44.0 bits (99), Expect = 7e-05 Identities = 24/58 (41%), Positives = 32/58 (55%), Gaps = 5/58 (8%) Frame = +2 Query: 329 VDLNGKTIKLQIWDTAGQER--FRTITSSY---YRGAHGIIIVYDCTDQDSFNTVKQW 487 ++L GKT+ L I DT G+ R F S+ YR G +IV+D TD+ SF V W Sbjct: 10 LELRGKTVHLHIVDTPGESRSVFHLAESTVPLIYRALSGAVIVFDVTDRKSFERVPTW 67 >SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) Length = 205 Score = 43.6 bits (98), Expect = 9e-05 Identities = 23/35 (65%), Positives = 26/35 (74%) Frame = +3 Query: 15 AVAAALELVDPPGCRNSAAADPFFSLFSTRNKELK 119 AVAAALELVDPPGCRNS D L ST+++E K Sbjct: 8 AVAAALELVDPPGCRNS--MDDIALLSSTKDREKK 40 >SB_47462| Best HMM Match : Ras (HMM E-Value=0) Length = 385 Score = 43.6 bits (98), Expect = 9e-05 Identities = 21/75 (28%), Positives = 40/75 (53%) Frame = +2 Query: 257 LRFADDTYTESYISTIGVDFKIRTVDLNGKTIKLQIWDTAGQERFRTITSSYYRGAHGII 436 ++F + E Y TI DF + ++++ L+I DTAG E+F ++ Y + G + Sbjct: 21 VQFVTGQFVEKYDPTIE-DFYRKEIEVDNNPSILEILDTAGTEQFASMRDLYIKNGQGFL 79 Query: 437 IVYDCTDQDSFNTVK 481 +VY ++ +F +K Sbjct: 80 LVYSLINRQTFADLK 94 >SB_18671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 43.2 bits (97), Expect = 1e-04 Identities = 22/33 (66%), Positives = 27/33 (81%) Frame = +3 Query: 15 AVAAALELVDPPGCRNSAAADPFFSLFSTRNKE 113 AVAAALELVDPPGCRNS ++P F+ F+ R K+ Sbjct: 8 AVAAALELVDPPGCRNS-MSNP-FAAFNQREKQ 38 >SB_56255| Best HMM Match : Arf (HMM E-Value=0) Length = 181 Score = 43.2 bits (97), Expect = 1e-04 Identities = 20/64 (31%), Positives = 33/64 (51%) Frame = +2 Query: 293 ISTIGVDFKIRTVDLNGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIIVYDCTDQDSFN 472 I TIG F + TV+ K I +WD GQ++ R + Y++ G+I V D D++ Sbjct: 46 IPTIG--FNVETVEY--KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVG 101 Query: 473 TVKQ 484 ++ Sbjct: 102 EARE 105 >SB_56254| Best HMM Match : Arf (HMM E-Value=5.3e-31) Length = 650 Score = 43.2 bits (97), Expect = 1e-04 Identities = 19/70 (27%), Positives = 36/70 (51%) Frame = +2 Query: 275 TYTESYISTIGVDFKIRTVDLNGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIIVYDCT 454 T+ ++ +S + F + TV+ K I +WD GQ++ R + Y++ G+I V D Sbjct: 488 THIQAMVSPVQ-GFNVETVEY--KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSN 544 Query: 455 DQDSFNTVKQ 484 D++ K+ Sbjct: 545 DRERAGEAKE 554 >SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) Length = 205 Score = 43.2 bits (97), Expect = 1e-04 Identities = 20/28 (71%), Positives = 23/28 (82%) Frame = +3 Query: 15 AVAAALELVDPPGCRNSAAADPFFSLFS 98 AVAAALELVDPPGCRNS A+ +S+ S Sbjct: 8 AVAAALELVDPPGCRNSMNANVSYSIVS 35 >SB_17524| Best HMM Match : Ras (HMM E-Value=2.1e-10) Length = 159 Score = 43.2 bits (97), Expect = 1e-04 Identities = 22/76 (28%), Positives = 39/76 (51%), Gaps = 1/76 (1%) Frame = +2 Query: 260 RFADDTYTESYISTIGVD-FKIRTVDLNGKTIKLQIWDTAGQERFRTITSSYYRGAHGII 436 R + D + E S +D I V + K +K+ +WDT G E + ++T ++Y + ++ Sbjct: 27 RLSTDEFPEEEQSLHHIDQCFIPLVCICNKKLKIHLWDTLGMEEYESLTRNHYSNSKVVL 86 Query: 437 IVYDCTDQDSFNTVKQ 484 +VY DS VK+ Sbjct: 87 VVYSLDLPDSLAQVKE 102 >SB_12680| Best HMM Match : Ras (HMM E-Value=3.4e-05) Length = 243 Score = 42.3 bits (95), Expect = 2e-04 Identities = 21/69 (30%), Positives = 33/69 (47%), Gaps = 6/69 (8%) Frame = +2 Query: 299 TIGVDFKIRTVDLN------GKTIKLQIWDTAGQERFRTITSSYYRGAHGIIIVYDCTDQ 460 TIGVDF + ++ T+KLQ WD A ERF +T+ Y R G ++ + Sbjct: 85 TIGVDFYVHFIEWRETDKKKDSTVKLQFWDVAEHERFLKMTAVYCRNCSGALVFWGPKSP 144 Query: 461 DSFNTVKQW 487 ++ +W Sbjct: 145 SRLSSALKW 153 >SB_39315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 41.5 bits (93), Expect = 4e-04 Identities = 18/24 (75%), Positives = 19/24 (79%) Frame = +3 Query: 15 AVAAALELVDPPGCRNSAAADPFF 86 AVAAALELVDPPGCRNS D + Sbjct: 8 AVAAALELVDPPGCRNSITKDKMY 31 >SB_38326| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 41.1 bits (92), Expect = 5e-04 Identities = 18/28 (64%), Positives = 22/28 (78%) Frame = +3 Query: 15 AVAAALELVDPPGCRNSAAADPFFSLFS 98 AVAAALELVDPPGCRNS + ++F+ Sbjct: 8 AVAAALELVDPPGCRNSIRSTTTITIFT 35 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 41.1 bits (92), Expect = 5e-04 Identities = 18/22 (81%), Positives = 18/22 (81%) Frame = +3 Query: 15 AVAAALELVDPPGCRNSAAADP 80 AVAAALELVDPPGCRNS P Sbjct: 95 AVAAALELVDPPGCRNSITGGP 116 >SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 40.7 bits (91), Expect = 7e-04 Identities = 20/32 (62%), Positives = 21/32 (65%) Frame = +3 Query: 15 AVAAALELVDPPGCRNSAAADPFFSLFSTRNK 110 AVAAALELVDPPGCRNS + LF K Sbjct: 8 AVAAALELVDPPGCRNSIDINDMKQLFECVGK 39 >SB_42884| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 40.3 bits (90), Expect = 9e-04 Identities = 18/23 (78%), Positives = 19/23 (82%) Frame = +3 Query: 15 AVAAALELVDPPGCRNSAAADPF 83 AVAAALELVDPPGCRNS + F Sbjct: 8 AVAAALELVDPPGCRNSIGQNGF 30 >SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 40.3 bits (90), Expect = 9e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = +3 Query: 15 AVAAALELVDPPGCRNSAA 71 AVAAALELVDPPGCRNS A Sbjct: 8 AVAAALELVDPPGCRNSIA 26 >SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) Length = 257 Score = 40.3 bits (90), Expect = 9e-04 Identities = 18/27 (66%), Positives = 20/27 (74%) Frame = +3 Query: 15 AVAAALELVDPPGCRNSAAADPFFSLF 95 AVAAALELVDPPGCRNS ++F Sbjct: 25 AVAAALELVDPPGCRNSIMDSGLITIF 51 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 40.3 bits (90), Expect = 9e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = +3 Query: 15 AVAAALELVDPPGCRNSAA 71 AVAAALELVDPPGCRNS A Sbjct: 84 AVAAALELVDPPGCRNSIA 102 >SB_11757| Best HMM Match : Ras (HMM E-Value=0) Length = 211 Score = 39.9 bits (89), Expect = 0.001 Identities = 23/76 (30%), Positives = 35/76 (46%), Gaps = 1/76 (1%) Frame = +2 Query: 272 DTYTESYISTIGVDFKIRTVDLNGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIIVYDC 451 D + SY+ T + + TV++N K ++ DTAGQE F + Y A I+ + Sbjct: 41 DGFPNSYVPTAFDTYHV-TVEVNKKLCMIEFCDTAGQEDFDALRPLCYSSADVFIVCFSV 99 Query: 452 TDQDSF-NTVKQWF*E 496 SF N +W E Sbjct: 100 VSPTSFANVASKWIPE 115 >SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 176 Score = 39.9 bits (89), Expect = 0.001 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 15 AVAAALELVDPPGCRNSAAA 74 AVAAALELVDPPGCRNS A Sbjct: 8 AVAAALELVDPPGCRNSIQA 27 >SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 39.5 bits (88), Expect = 0.002 Identities = 18/22 (81%), Positives = 18/22 (81%) Frame = +3 Query: 15 AVAAALELVDPPGCRNSAAADP 80 AVAAALELVDPPGCRNS P Sbjct: 28 AVAAALELVDPPGCRNSMPDRP 49 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 39.5 bits (88), Expect = 0.002 Identities = 18/26 (69%), Positives = 20/26 (76%) Frame = +3 Query: 15 AVAAALELVDPPGCRNSAAADPFFSL 92 AVAAALELVDPPGCRNS + + L Sbjct: 84 AVAAALELVDPPGCRNSMIYENYILL 109 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 39.5 bits (88), Expect = 0.002 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = +3 Query: 15 AVAAALELVDPPGCRNSAAA 74 AVAAALELVDPPGCRNS ++ Sbjct: 652 AVAAALELVDPPGCRNSISS 671 >SB_12762| Best HMM Match : Ras (HMM E-Value=2.2e-21) Length = 242 Score = 39.5 bits (88), Expect = 0.002 Identities = 23/78 (29%), Positives = 37/78 (47%) Frame = +2 Query: 254 VLRFADDTYTESYISTIGVDFKIRTVDLNGKTIKLQIWDTAGQERFRTITSSYYRGAHGI 433 +LRF + + Y TI DF I+ V N +T +LQI DT+G F + Sbjct: 45 ILRFLGYAFNDDYSPTIE-DFFIKHVFFNNETYELQIIDTSGTYEFPAMRKVDIAKGDAF 103 Query: 434 IIVYDCTDQDSFNTVKQW 487 ++VY +SF + ++ Sbjct: 104 VLVYSQDHPESFTKLNRY 121 >SB_8853| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 39.5 bits (88), Expect = 0.002 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = +3 Query: 195 YDYLFKLLLIGDSGVGKSCL 254 YDYLFK++LIGDSGVGKS L Sbjct: 15 YDYLFKIVLIGDSGVGKSNL 34 Score = 38.7 bits (86), Expect = 0.003 Identities = 15/27 (55%), Positives = 21/27 (77%) Frame = +2 Query: 296 STIGVDFKIRTVDLNGKTIKLQIWDTA 376 +TIGV+ R V++ GKT++ QIWDTA Sbjct: 49 ATIGVELAHRNVEIEGKTVRAQIWDTA 75 >SB_55976| Best HMM Match : zf-C3HC4 (HMM E-Value=0.087) Length = 171 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +3 Query: 15 AVAAALELVDPPGCRNS 65 AVAAALELVDPPGCRNS Sbjct: 8 AVAAALELVDPPGCRNS 24 >SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +3 Query: 15 AVAAALELVDPPGCRNS 65 AVAAALELVDPPGCRNS Sbjct: 8 AVAAALELVDPPGCRNS 24 >SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +3 Query: 15 AVAAALELVDPPGCRNS 65 AVAAALELVDPPGCRNS Sbjct: 8 AVAAALELVDPPGCRNS 24 >SB_51325| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +3 Query: 15 AVAAALELVDPPGCRNS 65 AVAAALELVDPPGCRNS Sbjct: 8 AVAAALELVDPPGCRNS 24 >SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +3 Query: 15 AVAAALELVDPPGCRNS 65 AVAAALELVDPPGCRNS Sbjct: 8 AVAAALELVDPPGCRNS 24 >SB_43938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +3 Query: 15 AVAAALELVDPPGCRNS 65 AVAAALELVDPPGCRNS Sbjct: 8 AVAAALELVDPPGCRNS 24 >SB_42082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +3 Query: 15 AVAAALELVDPPGCRNS 65 AVAAALELVDPPGCRNS Sbjct: 8 AVAAALELVDPPGCRNS 24 >SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87) Length = 209 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +3 Query: 15 AVAAALELVDPPGCRNS 65 AVAAALELVDPPGCRNS Sbjct: 8 AVAAALELVDPPGCRNS 24 >SB_36172| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +3 Query: 15 AVAAALELVDPPGCRNS 65 AVAAALELVDPPGCRNS Sbjct: 8 AVAAALELVDPPGCRNS 24 >SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +3 Query: 15 AVAAALELVDPPGCRNS 65 AVAAALELVDPPGCRNS Sbjct: 8 AVAAALELVDPPGCRNS 24 >SB_30147| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +3 Query: 15 AVAAALELVDPPGCRNS 65 AVAAALELVDPPGCRNS Sbjct: 8 AVAAALELVDPPGCRNS 24 >SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +3 Query: 15 AVAAALELVDPPGCRNS 65 AVAAALELVDPPGCRNS Sbjct: 8 AVAAALELVDPPGCRNS 24 >SB_26655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 48 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +3 Query: 15 AVAAALELVDPPGCRNS 65 AVAAALELVDPPGCRNS Sbjct: 8 AVAAALELVDPPGCRNS 24 >SB_25292| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +3 Query: 15 AVAAALELVDPPGCRNS 65 AVAAALELVDPPGCRNS Sbjct: 8 AVAAALELVDPPGCRNS 24 >SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) Length = 183 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +3 Query: 15 AVAAALELVDPPGCRNS 65 AVAAALELVDPPGCRNS Sbjct: 8 AVAAALELVDPPGCRNS 24 >SB_21491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 52 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +3 Query: 15 AVAAALELVDPPGCRNS 65 AVAAALELVDPPGCRNS Sbjct: 8 AVAAALELVDPPGCRNS 24 >SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +3 Query: 15 AVAAALELVDPPGCRNS 65 AVAAALELVDPPGCRNS Sbjct: 8 AVAAALELVDPPGCRNS 24 >SB_15561| Best HMM Match : Protamine_P2 (HMM E-Value=8.8) Length = 182 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +3 Query: 15 AVAAALELVDPPGCRNS 65 AVAAALELVDPPGCRNS Sbjct: 8 AVAAALELVDPPGCRNS 24 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +3 Query: 15 AVAAALELVDPPGCRNS 65 AVAAALELVDPPGCRNS Sbjct: 65 AVAAALELVDPPGCRNS 81 >SB_9600| Best HMM Match : DUF1596 (HMM E-Value=9.6) Length = 205 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +3 Query: 15 AVAAALELVDPPGCRNS 65 AVAAALELVDPPGCRNS Sbjct: 8 AVAAALELVDPPGCRNS 24 >SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +3 Query: 15 AVAAALELVDPPGCRNS 65 AVAAALELVDPPGCRNS Sbjct: 8 AVAAALELVDPPGCRNS 24 >SB_8545| Best HMM Match : C2 (HMM E-Value=0.00073) Length = 106 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +3 Query: 15 AVAAALELVDPPGCRNS 65 AVAAALELVDPPGCRNS Sbjct: 8 AVAAALELVDPPGCRNS 24 >SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +3 Query: 15 AVAAALELVDPPGCRNS 65 AVAAALELVDPPGCRNS Sbjct: 8 AVAAALELVDPPGCRNS 24 >SB_967| Best HMM Match : Calx-beta (HMM E-Value=2.8) Length = 123 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +3 Query: 15 AVAAALELVDPPGCRNS 65 AVAAALELVDPPGCRNS Sbjct: 8 AVAAALELVDPPGCRNS 24 >SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 272 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +3 Query: 15 AVAAALELVDPPGCRNS 65 AVAAALELVDPPGCRNS Sbjct: 8 AVAAALELVDPPGCRNS 24 >SB_56708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +3 Query: 15 AVAAALELVDPPGCRNS 65 AVAAALELVDPPGCRNS Sbjct: 8 AVAAALELVDPPGCRNS 24 >SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +3 Query: 15 AVAAALELVDPPGCRNS 65 AVAAALELVDPPGCRNS Sbjct: 63 AVAAALELVDPPGCRNS 79 >SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +3 Query: 15 AVAAALELVDPPGCRNS 65 AVAAALELVDPPGCRNS Sbjct: 25 AVAAALELVDPPGCRNS 41 >SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) Length = 179 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +3 Query: 15 AVAAALELVDPPGCRNS 65 AVAAALELVDPPGCRNS Sbjct: 8 AVAAALELVDPPGCRNS 24 >SB_45805| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +3 Query: 15 AVAAALELVDPPGCRNS 65 AVAAALELVDPPGCRNS Sbjct: 8 AVAAALELVDPPGCRNS 24 >SB_45526| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +3 Query: 15 AVAAALELVDPPGCRNS 65 AVAAALELVDPPGCRNS Sbjct: 8 AVAAALELVDPPGCRNS 24 >SB_40500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +3 Query: 15 AVAAALELVDPPGCRNS 65 AVAAALELVDPPGCRNS Sbjct: 8 AVAAALELVDPPGCRNS 24 >SB_39283| Best HMM Match : ADK (HMM E-Value=3.7) Length = 171 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +3 Query: 15 AVAAALELVDPPGCRNS 65 AVAAALELVDPPGCRNS Sbjct: 8 AVAAALELVDPPGCRNS 24 >SB_38562| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +3 Query: 15 AVAAALELVDPPGCRNS 65 AVAAALELVDPPGCRNS Sbjct: 8 AVAAALELVDPPGCRNS 24 >SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +3 Query: 15 AVAAALELVDPPGCRNS 65 AVAAALELVDPPGCRNS Sbjct: 45 AVAAALELVDPPGCRNS 61 >SB_18780| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 212 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +3 Query: 15 AVAAALELVDPPGCRNS 65 AVAAALELVDPPGCRNS Sbjct: 8 AVAAALELVDPPGCRNS 24 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +3 Query: 15 AVAAALELVDPPGCRNS 65 AVAAALELVDPPGCRNS Sbjct: 95 AVAAALELVDPPGCRNS 111 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +3 Query: 15 AVAAALELVDPPGCRNS 65 AVAAALELVDPPGCRNS Sbjct: 71 AVAAALELVDPPGCRNS 87 >SB_5183| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +3 Query: 15 AVAAALELVDPPGCRNS 65 AVAAALELVDPPGCRNS Sbjct: 8 AVAAALELVDPPGCRNS 24 >SB_7588| Best HMM Match : DcpS (HMM E-Value=0) Length = 446 Score = 37.9 bits (84), Expect = 0.005 Identities = 13/39 (33%), Positives = 23/39 (58%) Frame = +2 Query: 368 DTAGQERFRTITSSYYRGAHGIIIVYDCTDQDSFNTVKQ 484 D GQ++ R + Y+ G+ G+I V DC D+D + ++ Sbjct: 143 DVGGQDKIRPLWRHYFAGSQGLIFVVDCADRDRIDEARK 181 >SB_11841| Best HMM Match : Ras (HMM E-Value=0) Length = 523 Score = 37.5 bits (83), Expect = 0.006 Identities = 19/62 (30%), Positives = 28/62 (45%), Gaps = 1/62 (1%) Frame = +2 Query: 305 GVDFKIRTVDLNGKT-IKLQIWDTAGQERFRTITSSYYRGAHGIIIVYDCTDQDSFNTVK 481 GV + + GK K I DTAGQE + + Y R G + V+ + SF + Sbjct: 261 GVGHRAHSYSKGGKNKSKTDILDTAGQEEYSAMRDQYMRTGEGFLCVFAVNNSKSFEDIN 320 Query: 482 QW 487 Q+ Sbjct: 321 QY 322 >SB_43575| Best HMM Match : Sina (HMM E-Value=0) Length = 432 Score = 37.5 bits (83), Expect = 0.006 Identities = 15/37 (40%), Positives = 23/37 (62%) Frame = +2 Query: 368 DTAGQERFRTITSSYYRGAHGIIIVYDCTDQDSFNTV 478 DTAG+E++ ++S Y RGA I+ YD T + S + Sbjct: 278 DTAGEEKYAGLSSFYCRGASAAIVAYDITKESSLKVL 314 >SB_58217| Best HMM Match : Ras (HMM E-Value=0.00048) Length = 472 Score = 37.1 bits (82), Expect = 0.008 Identities = 13/43 (30%), Positives = 25/43 (58%) Frame = +2 Query: 356 LQIWDTAGQERFRTITSSYYRGAHGIIIVYDCTDQDSFNTVKQ 484 + +WDT G E + ++T ++Y + +++VY DS VK+ Sbjct: 1 IHLWDTLGMEEYESLTRNHYSNSKVVLVVYSLDLPDSLAQVKE 43 >SB_22528| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 467 Score = 36.7 bits (81), Expect = 0.011 Identities = 19/76 (25%), Positives = 37/76 (48%), Gaps = 1/76 (1%) Frame = +2 Query: 272 DTYTESYISTIGVDFKIRTVDLNGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIIVYDC 451 + + YI T+ ++ + L+GK + +WDTAGQE + + Y ++ +D Sbjct: 28 NAFPGEYIPTVFDNYS-SNIMLDGKAYNVGLWDTAGQEDYDRLRPLSYPMTDVFLVCFDI 86 Query: 452 TDQDSFNTVK-QWF*E 496 + SF ++ +W E Sbjct: 87 GSRTSFENIESKWLPE 102 >SB_6793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 36.3 bits (80), Expect = 0.014 Identities = 15/36 (41%), Positives = 19/36 (52%) Frame = +2 Query: 353 KLQIWDTAGQERFRTITSSYYRGAHGIIIVYDCTDQ 460 KL IWD GQ R+ +Y+ G+I V D DQ Sbjct: 3 KLNIWDVGGQRSLRSYWRNYFESTDGLIWVVDSADQ 38 >SB_6284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 35.9 bits (79), Expect = 0.019 Identities = 17/77 (22%), Positives = 37/77 (48%) Frame = +2 Query: 254 VLRFADDTYTESYISTIGVDFKIRTVDLNGKTIKLQIWDTAGQERFRTITSSYYRGAHGI 433 ++ + + + Y+ T+ ++ + TV + G+ L ++DTAGQE + + Y Sbjct: 20 LISYTTNKFPSEYVPTVFDNYAV-TVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVF 78 Query: 434 IIVYDCTDQDSFNTVKQ 484 ++ + SF VK+ Sbjct: 79 LVCFSVVSPSSFENVKE 95 >SB_56256| Best HMM Match : Ras (HMM E-Value=8.9e-31) Length = 506 Score = 35.5 bits (78), Expect = 0.025 Identities = 17/79 (21%), Positives = 41/79 (51%), Gaps = 1/79 (1%) Frame = +2 Query: 263 FADDTYTESYISTIGVDFKIRTVDLNGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIIV 442 + + + E Y +T+ V+++G+ I+L +WDT+G E + + Y ++I Sbjct: 252 YVRNQFNEKYEATVFNSLST-AVEVDGERIELTLWDTSGHEDYDHVRPLSYNNVDIVLIC 310 Query: 443 YDCTDQDSFNTV-KQWF*E 496 +D + + +++ ++W E Sbjct: 311 FDISRPKTADSILEKWIIE 329 >SB_52002| Best HMM Match : Ras (HMM E-Value=2.3e-19) Length = 351 Score = 34.3 bits (75), Expect = 0.057 Identities = 22/72 (30%), Positives = 35/72 (48%), Gaps = 1/72 (1%) Frame = +2 Query: 254 VLRFADDTYTESYISTIGVDFKIRTVDLNGK-TIKLQIWDTAGQERFRTITSSYYRGAHG 430 V RF T++E Y T+G D ++V L+ L+I DTAG F + + A Sbjct: 124 VKRFISGTFSEQYTPTVG-DLYEKSVTLSKDFNAFLEIMDTAGSYPFPAMKKLTIQNADA 182 Query: 431 IIIVYDCTDQDS 466 ++VY ++ S Sbjct: 183 FVLVYSVDEKAS 194 >SB_18358| Best HMM Match : Arf (HMM E-Value=0) Length = 214 Score = 33.9 bits (74), Expect = 0.076 Identities = 17/56 (30%), Positives = 30/56 (53%), Gaps = 1/56 (1%) Frame = +2 Query: 290 YISTIGVD-FKIRTVDLNGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIIVYDCT 454 Y++T+ F + T+ K I+ ++WD G+E+ R + +Y R +I V D T Sbjct: 46 YVNTVPTTAFNVETIR-PFKGIRFKVWDIGGREQNRPLWKAYARQTDAVIYVVDST 100 >SB_58700| Best HMM Match : Ras (HMM E-Value=2.7e-15) Length = 857 Score = 32.7 bits (71), Expect = 0.17 Identities = 27/87 (31%), Positives = 38/87 (43%), Gaps = 5/87 (5%) Frame = +3 Query: 9 LPAVAAALELVDPPGCRNSAAADPFFSLFSTRN----KELKCFR*IRQLNCVXXXXXXXX 176 L +VA L + P N+ S F RN + ++ +RQL Sbjct: 601 LASVAVTLRVTTTPAALNAPLQGASHSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLS 660 Query: 177 XXXXPEY-DYLFKLLLIGDSGVGKSCL 254 E +YLFK+L+IGD GVGK+ L Sbjct: 661 WSTAGERREYLFKVLVIGDLGVGKTSL 687 Score = 29.5 bits (63), Expect = 1.6 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +2 Query: 410 YYRGAHGIIIVYDCTDQDSFNTVKQW 487 YY+ A G IV+D T +F+ V++W Sbjct: 710 YYKEAVGAFIVFDVTRASTFSAVQKW 735 >SB_53792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 31.9 bits (69), Expect = 0.31 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +2 Query: 428 GIIIVYDCTDQDSFNTVKQW 487 GI++VYD T +DSF + QW Sbjct: 4 GILLVYDITTEDSFKHISQW 23 >SB_49252| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 384 Score = 31.9 bits (69), Expect = 0.31 Identities = 11/44 (25%), Positives = 24/44 (54%) Frame = +2 Query: 356 LQIWDTAGQERFRTITSSYYRGAHGIIIVYDCTDQDSFNTVKQW 487 L + DT+G E +R +T Y + ++ + D S +++++W Sbjct: 65 LYLLDTSGLEEYRELTKIYLKNLDCVVFTFALNDPHSLSSLEKW 108 >SB_32162| Best HMM Match : Ras (HMM E-Value=4.7e-31) Length = 357 Score = 31.9 bits (69), Expect = 0.31 Identities = 12/57 (21%), Positives = 31/57 (54%), Gaps = 1/57 (1%) Frame = +2 Query: 329 VDLNGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIIVYDCTDQDSFNTVK-QWF*E 496 +++ + L +WDT G + + Y+G+ I++ +D +++ +F ++ +W E Sbjct: 45 LEVGSQKFLLDLWDTEGTTEYDRLRPLTYQGSDIILLCFDISNRQTFERIESKWLPE 101 >SB_25972| Best HMM Match : MIF4G (HMM E-Value=4.9e-40) Length = 1265 Score = 31.5 bits (68), Expect = 0.40 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +2 Query: 410 YYRGAHGIIIVYDCTDQDSFNTVKQWF*E 496 YYRGA G ++VYD ++ V++W E Sbjct: 2 YYRGAVGALLVYDIAKHLTYENVERWLKE 30 >SB_54000| Best HMM Match : MMR_HSR1 (HMM E-Value=1.8) Length = 65 Score = 31.5 bits (68), Expect = 0.40 Identities = 14/19 (73%), Positives = 16/19 (84%) Frame = +3 Query: 198 DYLFKLLLIGDSGVGKSCL 254 DYL K+LLIGDS VGK+ L Sbjct: 10 DYLLKVLLIGDSNVGKTKL 28 >SB_45519| Best HMM Match : RNB (HMM E-Value=1.6e-35) Length = 2748 Score = 31.5 bits (68), Expect = 0.40 Identities = 13/51 (25%), Positives = 25/51 (49%) Frame = +2 Query: 329 VDLNGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIIVYDCTDQDSFNTVK 481 +D GK +++ DTAGQE + + S ++++ S+N +K Sbjct: 2626 IDYCGKLYDIEVVDTAGQEEYTSFRDSSLATGDAFLVLFAINSASSWNELK 2676 >SB_2880| Best HMM Match : Ras (HMM E-Value=3.2e-17) Length = 134 Score = 31.1 bits (67), Expect = 0.53 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +2 Query: 410 YYRGAHGIIIVYDCTDQDSFNTVKQW 487 Y R G II+Y TD+ SFN Q+ Sbjct: 5 YMRNGEGFIIIYSITDRSSFNLAAQY 30 >SB_24444| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 268 Score = 30.7 bits (66), Expect = 0.71 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = +2 Query: 398 ITSSYYRGAHGIIIVYDCTDQDSFNTVKQWF*E 496 + + +Y+ G ++VYD T ++SF + W E Sbjct: 6 VRNEFYKDTQGALLVYDVTSRESFEALDIWLDE 38 >SB_31439| Best HMM Match : Ras (HMM E-Value=4.7) Length = 55 Score = 30.7 bits (66), Expect = 0.71 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = +2 Query: 398 ITSSYYRGAHGIIIVYDCTDQDSFNTVKQWF*E 496 + + +Y+ G ++VYD T ++SF + W E Sbjct: 1 VRNEFYKDTQGALLVYDVTSRESFEALDIWLDE 33 >SB_15207| Best HMM Match : Arf (HMM E-Value=1.9e-05) Length = 259 Score = 29.9 bits (64), Expect = 1.2 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +2 Query: 305 GVDFKIRTVDLNGKTIKLQIWDTAGQERFRTITSSYY 415 G F + TV+ +++K IWD G ++ R + YY Sbjct: 220 GAGFNVETVE--HRSLKFTIWDVGGLQKLRPLWRHYY 254 >SB_1071| Best HMM Match : Ras (HMM E-Value=0) Length = 228 Score = 29.9 bits (64), Expect = 1.2 Identities = 11/39 (28%), Positives = 22/39 (56%) Frame = +2 Query: 365 WDTAGQERFRTITSSYYRGAHGIIIVYDCTDQDSFNTVK 481 + TAG E+F ++ Y + G ++VY ++ +F +K Sbjct: 40 YHTAGTEQFASMRDLYIKNGQGFLLVYSLINRQTFADLK 78 >SB_32972| Best HMM Match : Arf (HMM E-Value=2.66247e-44) Length = 257 Score = 29.5 bits (63), Expect = 1.6 Identities = 17/63 (26%), Positives = 28/63 (44%), Gaps = 2/63 (3%) Frame = +2 Query: 302 IGVDFKIRTVDLNGKTIKLQIWDTA--GQERFRTITSSYYRGAHGIIIVYDCTDQDSFNT 475 + V K+ + ++GK + + I ++ GQ R YY +I V D D+D Sbjct: 128 MSVSGKLVIMSVSGKLVIMSILNSLIPGQTSIRPYWRCYYANTDAVIYVVDSVDKDRIGI 187 Query: 476 VKQ 484 KQ Sbjct: 188 SKQ 190 >SB_31629| Best HMM Match : DEAD (HMM E-Value=1.2e-05) Length = 415 Score = 29.5 bits (63), Expect = 1.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +3 Query: 33 ELVDPPGCRNS 65 ELVDPPGCRNS Sbjct: 319 ELVDPPGCRNS 329 >SB_214| Best HMM Match : Arf (HMM E-Value=0) Length = 148 Score = 29.5 bits (63), Expect = 1.6 Identities = 10/36 (27%), Positives = 18/36 (50%) Frame = +2 Query: 350 IKLQIWDTAGQERFRTITSSYYRGAHGIIIVYDCTD 457 ++ +D G + R I Y+ +GI+ + DC D Sbjct: 20 MRFTTFDLGGHRQARRIWKDYFPAVNGIVFIIDCAD 55 >SB_39298| Best HMM Match : Ras (HMM E-Value=0.11) Length = 64 Score = 29.1 bits (62), Expect = 2.2 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +2 Query: 395 TITSSYYRGAHGIIIVYDCTDQDSFNTVKQ 484 ++ S R A I+VY TD++SFNT Q Sbjct: 4 SLYESSIRWADAFIVVYSITDKNSFNTAVQ 33 >SB_12958| Best HMM Match : Ras (HMM E-Value=6e-13) Length = 168 Score = 29.1 bits (62), Expect = 2.2 Identities = 15/50 (30%), Positives = 24/50 (48%) Frame = +2 Query: 335 LNGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIIVYDCTDQDSFNTVKQ 484 + +++L I DTAG +SY G ++VY TD S+ +Q Sbjct: 10 IGDSSMELDILDTAGNGE-----ASYIHNGDGFVVVYSITDYYSYEMARQ 54 >SB_19218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 28.3 bits (60), Expect = 3.8 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +3 Query: 12 PAVAAALELVDPPG 53 P VA ALELVDPPG Sbjct: 52 PQVAPALELVDPPG 65 >SB_47450| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 27.9 bits (59), Expect = 5.0 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = +2 Query: 305 GVDFKIRTVDLNGKTIKLQIWDTAGQERFRTITSSYYR 418 G+ IRT D+ L++ D G+ER T+ S +R Sbjct: 39 GLHLNIRTADIVNLRTMLELLDVEGEERHVTLPYSIHR 76 >SB_24106| Best HMM Match : Ras (HMM E-Value=1e-35) Length = 263 Score = 27.9 bits (59), Expect = 5.0 Identities = 9/19 (47%), Positives = 16/19 (84%) Frame = +3 Query: 198 DYLFKLLLIGDSGVGKSCL 254 D+++++ L+GD GVGK+ L Sbjct: 3 DHVYRIALLGDEGVGKTAL 21 >SB_38097| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1099 Score = 27.5 bits (58), Expect = 6.6 Identities = 13/41 (31%), Positives = 20/41 (48%) Frame = +2 Query: 305 GVDFKIRTVDLNGKTIKLQIWDTAGQERFRTITSSYYRGAH 427 G+ IRT D+ L++ D G+ER T+ + R H Sbjct: 1024 GLHLNIRTADIVNLGTMLELLDIEGEERHVTLPYTIRRNVH 1064 >SB_51788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 414 Score = 27.1 bits (57), Expect = 8.7 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +3 Query: 210 KLLLIGDSGVGKSCL 254 KL+L+GD+G+GKS L Sbjct: 7 KLVLVGDAGIGKSTL 21 >SB_35038| Best HMM Match : Ras (HMM E-Value=6.8e-13) Length = 322 Score = 27.1 bits (57), Expect = 8.7 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = +2 Query: 401 TSSYYRGAHGIIIVYDCTDQDSFNTVKQW 487 T S + + +I+ YD +++ SFN +W Sbjct: 55 TDSVWEHPNLVIVAYDVSNEQSFNACNKW 83 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,791,860 Number of Sequences: 59808 Number of extensions: 251649 Number of successful extensions: 2122 Number of sequences better than 10.0: 140 Number of HSP's better than 10.0 without gapping: 2040 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2117 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1087245449 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -