BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1073 (501 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF127647-1|ABL74413.1| 213|Anopheles gambiae Rab5 protein. 81 3e-17 AJ438610-3|CAD27475.1| 190|Anopheles gambiae putative RHO small... 40 6e-05 EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 23 7.7 >EF127647-1|ABL74413.1| 213|Anopheles gambiae Rab5 protein. Length = 213 Score = 80.6 bits (190), Expect = 3e-17 Identities = 36/78 (46%), Positives = 48/78 (61%) Frame = +2 Query: 254 VLRFADDTYTESYISTIGVDFKIRTVDLNGKTIKLQIWDTAGQERFRTITSSYYRGAHGI 433 VLRF + E STIG F +T+ ++ T+K +IWDTAGQER+ ++ YYRGA Sbjct: 41 VLRFVKGQFHEYQESTIGAAFLTQTLCIDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAA 100 Query: 434 IIVYDCTDQDSFNTVKQW 487 I+VYD + DSF K W Sbjct: 101 IVVYDIQNSDSFARAKTW 118 Score = 26.6 bits (56), Expect = 0.47 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +3 Query: 207 FKLLLIGDSGVGKSCL 254 FKL+L+G+S VGKS L Sbjct: 25 FKLVLLGESAVGKSSL 40 >AJ438610-3|CAD27475.1| 190|Anopheles gambiae putative RHO small GTPase protein. Length = 190 Score = 39.5 bits (88), Expect = 6e-05 Identities = 21/82 (25%), Positives = 38/82 (46%), Gaps = 1/82 (1%) Frame = +2 Query: 254 VLRFADDTYTESYISTIGVDFKIRTVDLNGKTIKLQIWDTAGQERFRTITSSYYRGAHGI 433 ++ + D++ Y+ T ++ V ++G + L +WDTAGQE + + Y Sbjct: 23 LISYTTDSFPGEYVPTSFDNYSAPMV-VDGVQVSLGLWDTAGQEDYDRLRPLSYPQTDVF 81 Query: 434 IIVYDCTDQDSF-NTVKQWF*E 496 +I Y SF N +W+ E Sbjct: 82 LICYSVASPSSFENVTSKWYPE 103 Score = 22.6 bits (46), Expect = 7.7 Identities = 7/15 (46%), Positives = 12/15 (80%) Frame = +3 Query: 210 KLLLIGDSGVGKSCL 254 K +++GD VGK+C+ Sbjct: 8 KCVVVGDGTVGKTCM 22 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 22.6 bits (46), Expect = 7.7 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = -3 Query: 349 CLAI*VYSPNFKVHANSTDVAL 284 C+A+ VY+P +NST+ AL Sbjct: 127 CVALAVYTPFPNSDSNSTNAAL 148 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 457,771 Number of Sequences: 2352 Number of extensions: 8041 Number of successful extensions: 8 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 44823054 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -