BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1072 (412 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z66500-6|CAA91309.1| 318|Caenorhabditis elegans Hypothetical pr... 27 7.0 Z29094-8|CAA82337.1| 254|Caenorhabditis elegans Hypothetical pr... 27 7.0 U61948-2|AAB03143.2| 345|Caenorhabditis elegans Collagen protei... 26 9.2 M25480-1|AAA27986.1| 326|Caenorhabditis elegans collagen protein. 26 9.2 AF022985-9|AAB69960.1| 314|Caenorhabditis elegans Collagen prot... 26 9.2 >Z66500-6|CAA91309.1| 318|Caenorhabditis elegans Hypothetical protein T05C12.8 protein. Length = 318 Score = 26.6 bits (56), Expect = 7.0 Identities = 9/19 (47%), Positives = 15/19 (78%) Frame = +1 Query: 40 QLPSPPNDVAIYTSIGEEV 96 QL SPP D +++S+GE++ Sbjct: 179 QLTSPPADHGVFSSVGEKI 197 >Z29094-8|CAA82337.1| 254|Caenorhabditis elegans Hypothetical protein C07A9.10 protein. Length = 254 Score = 26.6 bits (56), Expect = 7.0 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = +3 Query: 252 ILPWSSNAFRFEGWGSRCNYTETLEPSQGVWRIYVVDVY 368 I PWS+ A + W + TET EP +++ V ++ Sbjct: 42 ITPWSTQAKDRKAWKAVIRTTETREPKNIIYKKQVTVLF 80 >U61948-2|AAB03143.2| 345|Caenorhabditis elegans Collagen protein 14 protein. Length = 345 Score = 26.2 bits (55), Expect = 9.2 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = -3 Query: 293 PPFKPKRITAPRQNRQGGGTYPCGLTRGP 207 PP +P P +N +GGG P GL P Sbjct: 281 PPGQPGPAGPPGENGKGGGQGPSGLPGPP 309 >M25480-1|AAA27986.1| 326|Caenorhabditis elegans collagen protein. Length = 326 Score = 26.2 bits (55), Expect = 9.2 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = -3 Query: 293 PPFKPKRITAPRQNRQGGGTYPCGLTRGP 207 PP +P P +N +GGG P GL P Sbjct: 262 PPGQPGPAGPPGENGKGGGQGPSGLPGPP 290 >AF022985-9|AAB69960.1| 314|Caenorhabditis elegans Collagen protein 141 protein. Length = 314 Score = 26.2 bits (55), Expect = 9.2 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = -3 Query: 302 TAAPPFKPKRITAPRQNRQGGGTYPCGLTRGPT 204 T P P AP Q+ GGG P G T GPT Sbjct: 151 TPGAPGAPGNAGAPGQDSFGGGPGPAGPT-GPT 182 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,236,296 Number of Sequences: 27780 Number of extensions: 194989 Number of successful extensions: 399 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 396 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 399 length of database: 12,740,198 effective HSP length: 74 effective length of database: 10,684,478 effective search space used: 662437636 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -