BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1072 (412 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g31250.1 68415.m03816 glutamyl-tRNA reductase, putative simil... 27 4.9 At4g04570.1 68417.m00670 protein kinase family protein contains ... 26 8.6 >At2g31250.1 68415.m03816 glutamyl-tRNA reductase, putative similar to HEMA2 [SP|P49294], HEMA1 [SP|P42804] Length = 524 Score = 27.1 bits (57), Expect = 4.9 Identities = 16/37 (43%), Positives = 20/37 (54%) Frame = +3 Query: 252 ILPWSSNAFRFEGWGSRCNYTETLEPSQGVWRIYVVD 362 IL + R++G GS ETLE Q V RIY +D Sbjct: 474 ILDYPMKHLRYDGTGSS-KLRETLENMQAVNRIYELD 509 >At4g04570.1 68417.m00670 protein kinase family protein contains Pfam domain PF00069: Protein kinase domain Length = 654 Score = 26.2 bits (55), Expect = 8.6 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = -1 Query: 148 LFLISIVCCRLQDNHTPRPLLQSMCRWLHRLEVMVAVTK 32 L I ++C +Q+N T RP + S+ WL +++ + K Sbjct: 589 LIQIGLLC--VQENSTKRPTMSSVIIWLGSETIIIPLPK 625 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,751,871 Number of Sequences: 28952 Number of extensions: 184554 Number of successful extensions: 449 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 434 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 449 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 615542944 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -