Bombyx BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--1070
         (471 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q2G9C7 Cluster: Putative arginyl-tRNA--protein transfer...    32   7.3  

>UniRef50_Q2G9C7 Cluster: Putative arginyl-tRNA--protein
           transferase; n=7; Sphingomonadales|Rep: Putative
           arginyl-tRNA--protein transferase - Novosphingobium
           aromaticivorans (strain DSM 12444)
          Length = 284

 Score = 31.9 bits (69), Expect = 7.3
 Identities = 20/70 (28%), Positives = 34/70 (48%), Gaps = 1/70 (1%)
 Frame = +1

Query: 115 ISYNRLYCTYPIA*TLLLLQSSKRCFTTLATGNTNQLAQ-ITRVGKWRSKTGLVFQTCIS 291
           + + R + T P     L  +S ++ FT L   N ++L   + R+G  RS+T     +CI 
Sbjct: 5   VRFPRFFVTSPAPCPYLPGRSERKVFTELKGANADELNDALGRIGFRRSQTVAYRPSCID 64

Query: 292 CGCEMPVSIV 321
           C   + V +V
Sbjct: 65  CQACVSVRVV 74


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 474,718,473
Number of Sequences: 1657284
Number of extensions: 9057771
Number of successful extensions: 18171
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 17907
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 18170
length of database: 575,637,011
effective HSP length: 94
effective length of database: 419,852,315
effective search space used: 26030843530
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)