BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= ce--1070
(471 letters)
Database: uniref50
1,657,284 sequences; 575,637,011 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
UniRef50_Q2G9C7 Cluster: Putative arginyl-tRNA--protein transfer... 32 7.3
>UniRef50_Q2G9C7 Cluster: Putative arginyl-tRNA--protein
transferase; n=7; Sphingomonadales|Rep: Putative
arginyl-tRNA--protein transferase - Novosphingobium
aromaticivorans (strain DSM 12444)
Length = 284
Score = 31.9 bits (69), Expect = 7.3
Identities = 20/70 (28%), Positives = 34/70 (48%), Gaps = 1/70 (1%)
Frame = +1
Query: 115 ISYNRLYCTYPIA*TLLLLQSSKRCFTTLATGNTNQLAQ-ITRVGKWRSKTGLVFQTCIS 291
+ + R + T P L +S ++ FT L N ++L + R+G RS+T +CI
Sbjct: 5 VRFPRFFVTSPAPCPYLPGRSERKVFTELKGANADELNDALGRIGFRRSQTVAYRPSCID 64
Query: 292 CGCEMPVSIV 321
C + V +V
Sbjct: 65 CQACVSVRVV 74
Database: uniref50
Posted date: Oct 5, 2007 11:19 AM
Number of letters in database: 575,637,011
Number of sequences in database: 1,657,284
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 474,718,473
Number of Sequences: 1657284
Number of extensions: 9057771
Number of successful extensions: 18171
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 17907
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 18170
length of database: 575,637,011
effective HSP length: 94
effective length of database: 419,852,315
effective search space used: 26030843530
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -