BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1070 (471 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_01_0629 - 4582045-4582140,4582218-4582480,4582584-4582704,458... 30 1.1 01_01_0490 + 3620523-3623403,3623524-3623996 28 3.3 08_01_0570 - 5073138-5073410,5075386-5075530,5075561-5075754 28 4.4 01_07_0269 - 42414345-42415328,42415419-42415551,42415939-424160... 28 4.4 12_01_0628 - 5181814-5182344 27 5.8 10_07_0086 - 12755485-12756540,12756994-12757283,12757391-12757643 27 5.8 10_08_0804 + 20700414-20700723,20700813-20700924,20701380-207014... 27 7.6 >06_01_0629 - 4582045-4582140,4582218-4582480,4582584-4582704, 4582833-4583171,4583208-4583245,4583355-4583670, 4583753-4584006,4586417-4586546 Length = 518 Score = 29.9 bits (64), Expect = 1.1 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +2 Query: 251 GVRKRVSCFKPVFLAVVKCPFPLYNGFRGAVN 346 GVR+ + C V+ +K PL +GFR VN Sbjct: 51 GVRRNLGCLPEVYHKKLKIAVPLKHGFRAFVN 82 >01_01_0490 + 3620523-3623403,3623524-3623996 Length = 1117 Score = 28.3 bits (60), Expect = 3.3 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = -3 Query: 361 RPLDGVNGAAKTVVQWKRAFHNRKKYRFETRD 266 RP++ G +TVVQW R +RK+ E D Sbjct: 989 RPIEAAFGEGQTVVQWVREHLHRKRDPAEVID 1020 >08_01_0570 - 5073138-5073410,5075386-5075530,5075561-5075754 Length = 203 Score = 27.9 bits (59), Expect = 4.4 Identities = 13/42 (30%), Positives = 22/42 (52%) Frame = +1 Query: 184 RCFTTLATGNTNQLAQITRVGKWRSKTGLVFQTCISCGCEMP 309 R TTL ++++ + R +W + GL +Q+ S GC P Sbjct: 55 RLSTTLPLACCHRVSSVYR-SRWHCRLGLEYQSYSSSGCHRP 95 >01_07_0269 - 42414345-42415328,42415419-42415551,42415939-42416007, 42416459-42416672,42416785-42417040 Length = 551 Score = 27.9 bits (59), Expect = 4.4 Identities = 19/69 (27%), Positives = 36/69 (52%), Gaps = 2/69 (2%) Frame = -1 Query: 255 TPF--TDTSDLS*LIRIASGQGSKAPFTTLQQKQGSGYRVGTVQSVIRN*EKIFLDKDKA 82 TP+ TD DL I+ S + S +P+ L ++ G ++ +++ V +FL D Sbjct: 205 TPYRNTDLRDLKLFIQ-KSAKESTSPYRQLNIEEPLGPQLRSIKIVEYPTINVFLPSDSC 263 Query: 81 YYSVQEFLN 55 + V++F+N Sbjct: 264 DFEVEKFVN 272 >12_01_0628 - 5181814-5182344 Length = 176 Score = 27.5 bits (58), Expect = 5.8 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = -3 Query: 343 NGAAKTVVQWKRAFHNRKKYRFETR 269 +GA TVV W+RA+H R+ R E R Sbjct: 135 HGAQPTVV-WQRAWHGRRTARLEWR 158 >10_07_0086 - 12755485-12756540,12756994-12757283,12757391-12757643 Length = 532 Score = 27.5 bits (58), Expect = 5.8 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +1 Query: 178 SKRCFTTLATGNTNQLAQITRVGKWRSKTG 267 SKR FTT A GN + ++T+ G W++ G Sbjct: 100 SKRQFTTKA-GNKRRPTRVTKGGTWKASGG 128 >10_08_0804 + 20700414-20700723,20700813-20700924,20701380-20701467, 20702530-20702910 Length = 296 Score = 27.1 bits (57), Expect = 7.6 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +3 Query: 108 FLNFV*QIVLYLPYSLNLASAA 173 FLNF + +Y PYS+N S A Sbjct: 150 FLNFATSLAVYYPYSINYESHA 171 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,570,290 Number of Sequences: 37544 Number of extensions: 246336 Number of successful extensions: 463 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 459 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 463 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 955200320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -