BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1070 (471 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC036647-1|AAH36647.2| 940|Homo sapiens C10orf79 protein protein. 29 8.1 AL357336-5|CAI40459.1| 870|Homo sapiens novel protein protein. 29 8.1 AL139341-4|CAI17223.1| 870|Homo sapiens novel protein protein. 29 8.1 AL139341-2|CAI17221.1| 412|Homo sapiens novel protein protein. 29 8.1 AF013617-1|AAC39741.2| 153|Homo sapiens immunoglobulin heavy ch... 29 8.1 >BC036647-1|AAH36647.2| 940|Homo sapiens C10orf79 protein protein. Length = 940 Score = 29.1 bits (62), Expect = 8.1 Identities = 18/64 (28%), Positives = 31/64 (48%) Frame = +3 Query: 45 LTYHLKILAHYNKPCLCLKRSFLNFV*QIVLYLPYSLNLASAAE**KVLYYLGHWQYESA 224 LTY +I + + C C+ + +LN + ++ P SL+ A E V Y++ + ES Sbjct: 407 LTYSGEICVWWLEDCACVSKIYLNTLATVLACCPSSLSAAVGTEDGSV-YFISVYDKESP 465 Query: 225 SSDH 236 H Sbjct: 466 QVVH 469 >AL357336-5|CAI40459.1| 870|Homo sapiens novel protein protein. Length = 870 Score = 29.1 bits (62), Expect = 8.1 Identities = 18/64 (28%), Positives = 31/64 (48%) Frame = +3 Query: 45 LTYHLKILAHYNKPCLCLKRSFLNFV*QIVLYLPYSLNLASAAE**KVLYYLGHWQYESA 224 LTY +I + + C C+ + +LN + ++ P SL+ A E V Y++ + ES Sbjct: 337 LTYSGEICVWWLEDCACVSKIYLNTLATVLACCPSSLSAAVGTEDGSV-YFISVYDKESP 395 Query: 225 SSDH 236 H Sbjct: 396 QVVH 399 >AL139341-4|CAI17223.1| 870|Homo sapiens novel protein protein. Length = 870 Score = 29.1 bits (62), Expect = 8.1 Identities = 18/64 (28%), Positives = 31/64 (48%) Frame = +3 Query: 45 LTYHLKILAHYNKPCLCLKRSFLNFV*QIVLYLPYSLNLASAAE**KVLYYLGHWQYESA 224 LTY +I + + C C+ + +LN + ++ P SL+ A E V Y++ + ES Sbjct: 337 LTYSGEICVWWLEDCACVSKIYLNTLATVLACCPSSLSAAVGTEDGSV-YFISVYDKESP 395 Query: 225 SSDH 236 H Sbjct: 396 QVVH 399 >AL139341-2|CAI17221.1| 412|Homo sapiens novel protein protein. Length = 412 Score = 29.1 bits (62), Expect = 8.1 Identities = 18/64 (28%), Positives = 31/64 (48%) Frame = +3 Query: 45 LTYHLKILAHYNKPCLCLKRSFLNFV*QIVLYLPYSLNLASAAE**KVLYYLGHWQYESA 224 LTY +I + + C C+ + +LN + ++ P SL+ A E V Y++ + ES Sbjct: 337 LTYSGEICVWWLEDCACVSKIYLNTLATVLACCPSSLSAAVGTEDGSV-YFISVYDKESP 395 Query: 225 SSDH 236 H Sbjct: 396 QVVH 399 >AF013617-1|AAC39741.2| 153|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 153 Score = 29.1 bits (62), Expect = 8.1 Identities = 13/28 (46%), Positives = 19/28 (67%), Gaps = 2/28 (7%) Frame = +3 Query: 372 KNILFYLIIGSPNQKLLSKAQL--WGGG 449 KN+ F+L+ G +Q +LS+ QL WG G Sbjct: 5 KNLWFFLLPGGXSQMVLSQVQLQQWGAG 32 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 69,416,265 Number of Sequences: 237096 Number of extensions: 1381291 Number of successful extensions: 2207 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2140 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2207 length of database: 76,859,062 effective HSP length: 84 effective length of database: 56,942,998 effective search space used: 4099895856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -