BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1070 (471 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U75467-1|AAB18341.1| 724|Drosophila melanogaster Atu protein. 28 7.3 AY075403-1|AAL68232.1| 725|Drosophila melanogaster LD30655p pro... 28 7.3 AE014297-303|AAF51991.1| 725|Drosophila melanogaster CG1433-PA ... 28 7.3 AE014298-2653|AAF48791.2| 1108|Drosophila melanogaster CG15373-P... 27 9.7 >U75467-1|AAB18341.1| 724|Drosophila melanogaster Atu protein. Length = 724 Score = 27.9 bits (59), Expect = 7.3 Identities = 14/44 (31%), Positives = 22/44 (50%) Frame = -1 Query: 375 SFARHVR*MALTAPRKPLYNGNGHFTTARNTGLKHETRFRTPFT 244 S + H+ A R+PL + H + TGL+ ++ FRT T Sbjct: 468 SMSLHLGNEIFDAYRQPLLGDHNHLFVRQGTGLQGQSVFRTKLT 511 >AY075403-1|AAL68232.1| 725|Drosophila melanogaster LD30655p protein. Length = 725 Score = 27.9 bits (59), Expect = 7.3 Identities = 14/44 (31%), Positives = 22/44 (50%) Frame = -1 Query: 375 SFARHVR*MALTAPRKPLYNGNGHFTTARNTGLKHETRFRTPFT 244 S + H+ A R+PL + H + TGL+ ++ FRT T Sbjct: 469 SMSLHLGNEIFDAYRQPLLGDHNHLFVRQGTGLQGQSVFRTKLT 512 >AE014297-303|AAF51991.1| 725|Drosophila melanogaster CG1433-PA protein. Length = 725 Score = 27.9 bits (59), Expect = 7.3 Identities = 14/44 (31%), Positives = 22/44 (50%) Frame = -1 Query: 375 SFARHVR*MALTAPRKPLYNGNGHFTTARNTGLKHETRFRTPFT 244 S + H+ A R+PL + H + TGL+ ++ FRT T Sbjct: 469 SMSLHLGNEIFDAYRQPLLGDHNHLFVRQGTGLQGQSVFRTKLT 512 >AE014298-2653|AAF48791.2| 1108|Drosophila melanogaster CG15373-PA protein. Length = 1108 Score = 27.5 bits (58), Expect = 9.7 Identities = 16/68 (23%), Positives = 32/68 (47%) Frame = +1 Query: 178 SKRCFTTLATGNTNQLAQITRVGKWRSKTGLVFQTCISCGCEMPVSIVQRFSRRR*RHLT 357 S C + N N L Q R +WR + ++ CG E+P+S +++ ++ + + Sbjct: 262 SSYCLKHARSANANILRQTKR--EWRKRKEILQAMLDDCGREIPLSELEQLTQDQHSASS 319 Query: 358 DVTSKRTF 381 +RT+ Sbjct: 320 QPPRERTY 327 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,385,334 Number of Sequences: 53049 Number of extensions: 422371 Number of successful extensions: 774 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 773 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 774 length of database: 24,988,368 effective HSP length: 79 effective length of database: 20,797,497 effective search space used: 1601407269 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -