BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1070 (471 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g22990.1 68418.m02687 zinc finger (C2H2 type) family protein ... 27 6.4 At4g35770.1 68417.m05078 senescence-associated protein (SEN1) id... 27 6.4 >At5g22990.1 68418.m02687 zinc finger (C2H2 type) family protein contains Pfam domain, PF00096: Zinc finger, C2H2 type Length = 324 Score = 27.1 bits (57), Expect = 6.4 Identities = 10/30 (33%), Positives = 19/30 (63%), Gaps = 2/30 (6%) Frame = +3 Query: 9 VQKSHCGFDNSRLTYHLK--ILAHYNKPCL 92 V S GF+NS + YH++ +++ + PC+ Sbjct: 68 VSSSSFGFNNSHMAYHMRKNMVSTFGMPCI 97 >At4g35770.1 68417.m05078 senescence-associated protein (SEN1) identical to senescence-associated protein GI:1046270 from [Arabidopsis thaliana] Length = 182 Score = 27.1 bits (57), Expect = 6.4 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +1 Query: 235 TRVGKWRSKTGLVFQTCISCGCEMP 309 +R+G W S QTC S C++P Sbjct: 10 SRIGNWSSAISPPLQTCGSFKCQLP 34 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,330,682 Number of Sequences: 28952 Number of extensions: 202597 Number of successful extensions: 428 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 426 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 428 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 801831960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -