BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1068 (444 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY119569-1|AAM50223.1| 131|Drosophila melanogaster HL07933p pro... 33 0.23 AF154418-1|AAD38397.1| 131|Drosophila melanogaster anoxia upreg... 33 0.23 AE014297-1193|AAF54551.1| 131|Drosophila melanogaster CG6544-PC... 33 0.23 BT025937-1|ABG02181.1| 520|Drosophila melanogaster IP13955p pro... 30 1.6 >AY119569-1|AAM50223.1| 131|Drosophila melanogaster HL07933p protein. Length = 131 Score = 32.7 bits (71), Expect = 0.23 Identities = 18/35 (51%), Positives = 22/35 (62%), Gaps = 4/35 (11%) Frame = +2 Query: 32 MVYESDFYTTR----RPYRSTYSVTTPRHYVVVDR 124 MVYES F T R RP ++Y+VTTPR + DR Sbjct: 1 MVYESGFTTRRTYSSRPVTTSYAVTTPRLDLCTDR 35 >AF154418-1|AAD38397.1| 131|Drosophila melanogaster anoxia upregulated protein protein. Length = 131 Score = 32.7 bits (71), Expect = 0.23 Identities = 18/35 (51%), Positives = 22/35 (62%), Gaps = 4/35 (11%) Frame = +2 Query: 32 MVYESDFYTTR----RPYRSTYSVTTPRHYVVVDR 124 MVYES F T R RP ++Y+VTTPR + DR Sbjct: 1 MVYESGFTTRRTYSSRPVTTSYAVTTPRLDLCTDR 35 >AE014297-1193|AAF54551.1| 131|Drosophila melanogaster CG6544-PC, isoform C protein. Length = 131 Score = 32.7 bits (71), Expect = 0.23 Identities = 18/35 (51%), Positives = 22/35 (62%), Gaps = 4/35 (11%) Frame = +2 Query: 32 MVYESDFYTTR----RPYRSTYSVTTPRHYVVVDR 124 MVYES F T R RP ++Y+VTTPR + DR Sbjct: 1 MVYESGFTTRRTYSSRPVTTSYAVTTPRLDLCTDR 35 >BT025937-1|ABG02181.1| 520|Drosophila melanogaster IP13955p protein. Length = 520 Score = 29.9 bits (64), Expect = 1.6 Identities = 13/38 (34%), Positives = 17/38 (44%) Frame = -3 Query: 400 SRDAKRDKSSGGKWCRRAGGRCWWTSRSSLRDRRGCWS 287 S D + KW R+ G+CWW R R + WS Sbjct: 6 SEDEGKKLKRKSKW-RQLFGQCWWKKRRRQRSYQDYWS 42 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,550,853 Number of Sequences: 53049 Number of extensions: 186617 Number of successful extensions: 586 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 557 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 586 length of database: 24,988,368 effective HSP length: 78 effective length of database: 20,850,546 effective search space used: 1438687674 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -