BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1067 (428 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF065522-1|ABK59322.1| 255|Anopheles gambiae beta carbonic anhy... 27 0.28 U50479-1|AAA93478.1| 151|Anopheles gambiae protein ( Anopheles ... 23 4.6 CR954257-1|CAJ14152.1| 324|Anopheles gambiae putative dodecenoy... 23 4.6 >EF065522-1|ABK59322.1| 255|Anopheles gambiae beta carbonic anhydrase protein. Length = 255 Score = 27.1 bits (57), Expect = 0.28 Identities = 14/47 (29%), Positives = 26/47 (55%), Gaps = 2/47 (4%) Frame = +2 Query: 32 HREATSSGFVS-FSRVVIKKMPDSLFFTCVSKSLVLSRFS-SYVQDL 166 +R T V F +V P ++FFTC+ ++ +RF+ ++V D+ Sbjct: 11 YRHTTREQMVQEFRKVRDNPQPKAVFFTCMDSRMIPTRFTETHVGDM 57 >U50479-1|AAA93478.1| 151|Anopheles gambiae protein ( Anopheles gambiae putativeribosomal protein S13 mRNA, complete cds. ). Length = 151 Score = 23.0 bits (47), Expect = 4.6 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -3 Query: 369 IHSLSRFRLDKYLL*NLFNYQSSVCSALDA 280 IH L+R+ K +L + Y+SS SAL A Sbjct: 122 IHRLARYYKIKAVLPPNWKYESSTASALVA 151 >CR954257-1|CAJ14152.1| 324|Anopheles gambiae putative dodecenoylCoA deltaisomerase protein. Length = 324 Score = 23.0 bits (47), Expect = 4.6 Identities = 7/27 (25%), Positives = 16/27 (59%) Frame = +2 Query: 227 PNIRLDQSPMLCKVSFFCASKALQTLL 307 P R+ + P++C ++ +C + L+ L Sbjct: 133 PTRRMIRKPLVCAITGYCVAGGLELAL 159 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 415,088 Number of Sequences: 2352 Number of extensions: 7717 Number of successful extensions: 27 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 35292513 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -