BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1067 (428 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL034393-5|CAA22311.1| 362|Caenorhabditis elegans Hypothetical ... 29 1.1 AF159950-1|AAD45354.1| 362|Caenorhabditis elegans GSK-3 protein. 29 1.1 >AL034393-5|CAA22311.1| 362|Caenorhabditis elegans Hypothetical protein Y18D10A.5 protein. Length = 362 Score = 29.5 bits (63), Expect = 1.1 Identities = 14/41 (34%), Positives = 23/41 (56%) Frame = +1 Query: 208 DQRITNSKYTSRSVSNVM*GFIFLRI*GTTNAALVVKEVLK 330 DQ++ S Y + + N G +FL TTN + +K+VL+ Sbjct: 29 DQQVEISYYDQKVIGNGSFGVVFLAKLSTTNEMVAIKKVLQ 69 >AF159950-1|AAD45354.1| 362|Caenorhabditis elegans GSK-3 protein. Length = 362 Score = 29.5 bits (63), Expect = 1.1 Identities = 14/41 (34%), Positives = 23/41 (56%) Frame = +1 Query: 208 DQRITNSKYTSRSVSNVM*GFIFLRI*GTTNAALVVKEVLK 330 DQ++ S Y + + N G +FL TTN + +K+VL+ Sbjct: 29 DQQVEISYYDQKVIGNGSFGVVFLAKLSTTNEMVAIKKVLQ 69 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,305,553 Number of Sequences: 27780 Number of extensions: 170840 Number of successful extensions: 374 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 366 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 374 length of database: 12,740,198 effective HSP length: 75 effective length of database: 10,656,698 effective search space used: 713998766 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -