BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1067 (428 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g17370.1 68414.m02118 oligouridylate-binding protein, putativ... 27 7.1 At1g17840.1 68414.m02208 ABC transporter family protein similar ... 26 9.4 >At1g17370.1 68414.m02118 oligouridylate-binding protein, putative similar to oligouridylate binding protein [Nicotiana plumbaginifolia] GI:6996560; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 419 Score = 26.6 bits (56), Expect = 7.1 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +2 Query: 29 GHREATSSGFVSFSRVVIKKMPDSLFFTCVS 121 G RE TSS F F + ++ D++ FTC S Sbjct: 130 GQREDTSSHFNIFVGDLSPEVTDAMLFTCFS 160 >At1g17840.1 68414.m02208 ABC transporter family protein similar to ABC transporter GI:10280532 from [Homo sapiens] Length = 703 Score = 26.2 bits (55), Expect = 9.4 Identities = 14/39 (35%), Positives = 19/39 (48%), Gaps = 3/39 (7%) Frame = +1 Query: 22 FWRTPRSYVQRLCFIFKGSHKKDAR---FALLHMRFKIP 129 FWR P SY+ + +G ++ D R F FKIP Sbjct: 571 FWRYPMSYISFHFWALQGQYQNDLRGLTFDSQGSAFKIP 609 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,750,675 Number of Sequences: 28952 Number of extensions: 156070 Number of successful extensions: 357 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 353 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 357 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 675111616 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -