BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1066 (522 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_4994| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 6e-05 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 42 3e-04 SB_30147| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_36256| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_39315| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 5e-04 SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_38326| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_39283| Best HMM Match : ADK (HMM E-Value=3.7) 40 0.001 SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) 40 0.001 SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 40 0.002 SB_55976| Best HMM Match : zf-C3HC4 (HMM E-Value=0.087) 39 0.002 SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_51325| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_43938| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_42884| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_42082| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87) 39 0.002 SB_36172| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_26655| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_25292| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) 39 0.002 SB_21491| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_18671| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_15561| Best HMM Match : Protamine_P2 (HMM E-Value=8.8) 39 0.002 SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) 39 0.002 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 39 0.002 SB_9600| Best HMM Match : DUF1596 (HMM E-Value=9.6) 39 0.002 SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_8545| Best HMM Match : C2 (HMM E-Value=0.00073) 39 0.002 SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) 39 0.002 SB_967| Best HMM Match : Calx-beta (HMM E-Value=2.8) 39 0.002 SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_56708| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) 39 0.002 SB_45805| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_45526| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_40500| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_38562| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_18780| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 39 0.002 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_5183| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_58953| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.44 SB_32454| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_30707| Best HMM Match : ARID (HMM E-Value=4e-35) 30 1.3 SB_18023| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_31131| Best HMM Match : Drf_FH1 (HMM E-Value=2.4) 30 1.3 SB_44935| Best HMM Match : SAP (HMM E-Value=1.7e-09) 29 1.8 SB_31629| Best HMM Match : DEAD (HMM E-Value=1.2e-05) 29 1.8 SB_17534| Best HMM Match : Merozoite_SPAM (HMM E-Value=0.51) 29 3.1 SB_19218| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_34113| Best HMM Match : PSD5 (HMM E-Value=3.3) 28 4.1 SB_33564| Best HMM Match : RVT_1 (HMM E-Value=0.1) 28 5.4 SB_57869| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_14918| Best HMM Match : Extensin_2 (HMM E-Value=0.35) 27 9.4 SB_3708| Best HMM Match : DUF374 (HMM E-Value=2.2) 27 9.4 >SB_4994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 44.4 bits (100), Expect = 6e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +1 Query: 28 AVAAALELVDPPGCRNSAAAD 90 AVAAALELVDPPGCRNS AAD Sbjct: 8 AVAAALELVDPPGCRNSIAAD 28 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 41.9 bits (94), Expect = 3e-04 Identities = 18/24 (75%), Positives = 20/24 (83%) Frame = +1 Query: 28 AVAAALELVDPPGCRNSAAADPLN 99 AVAAALELVDPPGCRNS P++ Sbjct: 95 AVAAALELVDPPGCRNSITGGPVS 118 >SB_30147| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 41.5 bits (93), Expect = 4e-04 Identities = 26/55 (47%), Positives = 33/55 (60%), Gaps = 4/55 (7%) Frame = +1 Query: 28 AVAAALELVDPPGCRNS----AAADPLNFFFRHLRMRSIAGKLS*FVW*FALGGF 180 AVAAALELVDPPGCRNS +A+ NF F + + + + W FA+ GF Sbjct: 8 AVAAALELVDPPGCRNSIDNRRSAELSNFSF---GINLVGTEFTSLRWKFAMFGF 59 >SB_36256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 41.5 bits (93), Expect = 4e-04 Identities = 19/23 (82%), Positives = 19/23 (82%) Frame = +1 Query: 28 AVAAALELVDPPGCRNSAAADPL 96 AVAAALELVDPPGCRNS A L Sbjct: 8 AVAAALELVDPPGCRNSMVASEL 30 >SB_39315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 41.1 bits (92), Expect = 5e-04 Identities = 18/23 (78%), Positives = 19/23 (82%) Frame = +1 Query: 28 AVAAALELVDPPGCRNSAAADPL 96 AVAAALELVDPPGCRNS D + Sbjct: 8 AVAAALELVDPPGCRNSITKDKM 30 >SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 176 Score = 40.7 bits (91), Expect = 7e-04 Identities = 19/26 (73%), Positives = 21/26 (80%) Frame = +1 Query: 28 AVAAALELVDPPGCRNSAAADPLNFF 105 AVAAALELVDPPGCRNS A ++ F Sbjct: 8 AVAAALELVDPPGCRNSIQARSVDGF 33 >SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 40.7 bits (91), Expect = 7e-04 Identities = 18/24 (75%), Positives = 20/24 (83%) Frame = +1 Query: 28 AVAAALELVDPPGCRNSAAADPLN 99 AVAAALELVDPPGCRNS + +N Sbjct: 45 AVAAALELVDPPGCRNSINIESVN 68 >SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 40.3 bits (90), Expect = 0.001 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = +1 Query: 28 AVAAALELVDPPGCRNSAA 84 AVAAALELVDPPGCRNS A Sbjct: 8 AVAAALELVDPPGCRNSIA 26 >SB_38326| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 40.3 bits (90), Expect = 0.001 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = +1 Query: 22 FPAVAAALELVDPPGCRNS 78 F AVAAALELVDPPGCRNS Sbjct: 6 FIAVAAALELVDPPGCRNS 24 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 40.3 bits (90), Expect = 0.001 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = +1 Query: 28 AVAAALELVDPPGCRNSAA 84 AVAAALELVDPPGCRNS A Sbjct: 84 AVAAALELVDPPGCRNSIA 102 >SB_39283| Best HMM Match : ADK (HMM E-Value=3.7) Length = 171 Score = 39.9 bits (89), Expect = 0.001 Identities = 21/35 (60%), Positives = 24/35 (68%) Frame = +1 Query: 28 AVAAALELVDPPGCRNSAAADPLNFFFRHLRMRSI 132 AVAAALELVDPPGCRNS P N L +R++ Sbjct: 8 AVAAALELVDPPGCRNSMIM-PRNRLVTELVVRNL 41 >SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) Length = 205 Score = 39.9 bits (89), Expect = 0.001 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = +1 Query: 28 AVAAALELVDPPGCRNSAAAD 90 AVAAALELVDPPGCRNS A+ Sbjct: 8 AVAAALELVDPPGCRNSMNAN 28 >SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 39.5 bits (88), Expect = 0.002 Identities = 18/27 (66%), Positives = 20/27 (74%) Frame = +1 Query: 28 AVAAALELVDPPGCRNSAAADPLNFFF 108 AVAAALELVDPPGCRNS + + F Sbjct: 8 AVAAALELVDPPGCRNSIDINDMKQLF 34 >SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 39.5 bits (88), Expect = 0.002 Identities = 18/22 (81%), Positives = 18/22 (81%) Frame = +1 Query: 28 AVAAALELVDPPGCRNSAAADP 93 AVAAALELVDPPGCRNS P Sbjct: 28 AVAAALELVDPPGCRNSMPDRP 49 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 39.5 bits (88), Expect = 0.002 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = +1 Query: 28 AVAAALELVDPPGCRNSAAA 87 AVAAALELVDPPGCRNS ++ Sbjct: 652 AVAAALELVDPPGCRNSISS 671 >SB_55976| Best HMM Match : zf-C3HC4 (HMM E-Value=0.087) Length = 171 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 28 AVAAALELVDPPGCRNS 78 AVAAALELVDPPGCRNS Sbjct: 8 AVAAALELVDPPGCRNS 24 >SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 28 AVAAALELVDPPGCRNS 78 AVAAALELVDPPGCRNS Sbjct: 8 AVAAALELVDPPGCRNS 24 >SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 28 AVAAALELVDPPGCRNS 78 AVAAALELVDPPGCRNS Sbjct: 8 AVAAALELVDPPGCRNS 24 >SB_51325| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 28 AVAAALELVDPPGCRNS 78 AVAAALELVDPPGCRNS Sbjct: 8 AVAAALELVDPPGCRNS 24 >SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 28 AVAAALELVDPPGCRNS 78 AVAAALELVDPPGCRNS Sbjct: 8 AVAAALELVDPPGCRNS 24 >SB_43938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 28 AVAAALELVDPPGCRNS 78 AVAAALELVDPPGCRNS Sbjct: 8 AVAAALELVDPPGCRNS 24 >SB_42884| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 28 AVAAALELVDPPGCRNS 78 AVAAALELVDPPGCRNS Sbjct: 8 AVAAALELVDPPGCRNS 24 >SB_42082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 28 AVAAALELVDPPGCRNS 78 AVAAALELVDPPGCRNS Sbjct: 8 AVAAALELVDPPGCRNS 24 >SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87) Length = 209 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 28 AVAAALELVDPPGCRNS 78 AVAAALELVDPPGCRNS Sbjct: 8 AVAAALELVDPPGCRNS 24 >SB_36172| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 28 AVAAALELVDPPGCRNS 78 AVAAALELVDPPGCRNS Sbjct: 8 AVAAALELVDPPGCRNS 24 >SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 28 AVAAALELVDPPGCRNS 78 AVAAALELVDPPGCRNS Sbjct: 8 AVAAALELVDPPGCRNS 24 >SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 28 AVAAALELVDPPGCRNS 78 AVAAALELVDPPGCRNS Sbjct: 8 AVAAALELVDPPGCRNS 24 >SB_26655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 48 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 28 AVAAALELVDPPGCRNS 78 AVAAALELVDPPGCRNS Sbjct: 8 AVAAALELVDPPGCRNS 24 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 28 AVAAALELVDPPGCRNS 78 AVAAALELVDPPGCRNS Sbjct: 84 AVAAALELVDPPGCRNS 100 >SB_25292| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 28 AVAAALELVDPPGCRNS 78 AVAAALELVDPPGCRNS Sbjct: 8 AVAAALELVDPPGCRNS 24 >SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) Length = 183 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 28 AVAAALELVDPPGCRNS 78 AVAAALELVDPPGCRNS Sbjct: 8 AVAAALELVDPPGCRNS 24 >SB_21491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 52 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 28 AVAAALELVDPPGCRNS 78 AVAAALELVDPPGCRNS Sbjct: 8 AVAAALELVDPPGCRNS 24 >SB_18671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 28 AVAAALELVDPPGCRNS 78 AVAAALELVDPPGCRNS Sbjct: 8 AVAAALELVDPPGCRNS 24 >SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 28 AVAAALELVDPPGCRNS 78 AVAAALELVDPPGCRNS Sbjct: 8 AVAAALELVDPPGCRNS 24 >SB_15561| Best HMM Match : Protamine_P2 (HMM E-Value=8.8) Length = 182 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 28 AVAAALELVDPPGCRNS 78 AVAAALELVDPPGCRNS Sbjct: 8 AVAAALELVDPPGCRNS 24 >SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) Length = 257 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 28 AVAAALELVDPPGCRNS 78 AVAAALELVDPPGCRNS Sbjct: 25 AVAAALELVDPPGCRNS 41 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 28 AVAAALELVDPPGCRNS 78 AVAAALELVDPPGCRNS Sbjct: 65 AVAAALELVDPPGCRNS 81 >SB_9600| Best HMM Match : DUF1596 (HMM E-Value=9.6) Length = 205 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 28 AVAAALELVDPPGCRNS 78 AVAAALELVDPPGCRNS Sbjct: 8 AVAAALELVDPPGCRNS 24 >SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 28 AVAAALELVDPPGCRNS 78 AVAAALELVDPPGCRNS Sbjct: 8 AVAAALELVDPPGCRNS 24 >SB_8545| Best HMM Match : C2 (HMM E-Value=0.00073) Length = 106 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 28 AVAAALELVDPPGCRNS 78 AVAAALELVDPPGCRNS Sbjct: 8 AVAAALELVDPPGCRNS 24 >SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 28 AVAAALELVDPPGCRNS 78 AVAAALELVDPPGCRNS Sbjct: 8 AVAAALELVDPPGCRNS 24 >SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) Length = 205 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 28 AVAAALELVDPPGCRNS 78 AVAAALELVDPPGCRNS Sbjct: 8 AVAAALELVDPPGCRNS 24 >SB_967| Best HMM Match : Calx-beta (HMM E-Value=2.8) Length = 123 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 28 AVAAALELVDPPGCRNS 78 AVAAALELVDPPGCRNS Sbjct: 8 AVAAALELVDPPGCRNS 24 >SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 272 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 28 AVAAALELVDPPGCRNS 78 AVAAALELVDPPGCRNS Sbjct: 8 AVAAALELVDPPGCRNS 24 >SB_56708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 28 AVAAALELVDPPGCRNS 78 AVAAALELVDPPGCRNS Sbjct: 8 AVAAALELVDPPGCRNS 24 >SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 28 AVAAALELVDPPGCRNS 78 AVAAALELVDPPGCRNS Sbjct: 63 AVAAALELVDPPGCRNS 79 >SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 28 AVAAALELVDPPGCRNS 78 AVAAALELVDPPGCRNS Sbjct: 25 AVAAALELVDPPGCRNS 41 >SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) Length = 179 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 28 AVAAALELVDPPGCRNS 78 AVAAALELVDPPGCRNS Sbjct: 8 AVAAALELVDPPGCRNS 24 >SB_45805| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 28 AVAAALELVDPPGCRNS 78 AVAAALELVDPPGCRNS Sbjct: 8 AVAAALELVDPPGCRNS 24 >SB_45526| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 28 AVAAALELVDPPGCRNS 78 AVAAALELVDPPGCRNS Sbjct: 8 AVAAALELVDPPGCRNS 24 >SB_40500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 28 AVAAALELVDPPGCRNS 78 AVAAALELVDPPGCRNS Sbjct: 8 AVAAALELVDPPGCRNS 24 >SB_38562| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 28 AVAAALELVDPPGCRNS 78 AVAAALELVDPPGCRNS Sbjct: 8 AVAAALELVDPPGCRNS 24 >SB_18780| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 212 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 28 AVAAALELVDPPGCRNS 78 AVAAALELVDPPGCRNS Sbjct: 8 AVAAALELVDPPGCRNS 24 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 28 AVAAALELVDPPGCRNS 78 AVAAALELVDPPGCRNS Sbjct: 95 AVAAALELVDPPGCRNS 111 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 28 AVAAALELVDPPGCRNS 78 AVAAALELVDPPGCRNS Sbjct: 71 AVAAALELVDPPGCRNS 87 >SB_5183| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 28 AVAAALELVDPPGCRNS 78 AVAAALELVDPPGCRNS Sbjct: 8 AVAAALELVDPPGCRNS 24 >SB_58953| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 377 Score = 31.5 bits (68), Expect = 0.44 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = +1 Query: 403 MRGIKGLVWETSVLDADE 456 MRGIKGLV ETS+LD +E Sbjct: 1 MRGIKGLVTETSLLDPEE 18 >SB_32454| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1161 Score = 29.9 bits (64), Expect = 1.3 Identities = 13/37 (35%), Positives = 22/37 (59%) Frame = +1 Query: 259 RGLSAEQTNLKSILQEKIPKEQEKIREFRKKHGSTKV 369 RGL E+ +L+ +LQE K + +E ++ HG K+ Sbjct: 544 RGLKVEKEDLERVLQEAGEKVASQQKELKEAHGQRKL 580 >SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1375 Score = 29.9 bits (64), Expect = 1.3 Identities = 11/33 (33%), Positives = 22/33 (66%) Frame = -2 Query: 482 MDRPRKRIPSSASSTEVSQTRPLIPRMPPYIIS 384 M P + + ++A+ TE++ T+PL+P P ++S Sbjct: 366 MPAPTESVVTTATPTEIAVTKPLLPPKPSGLVS 398 >SB_30707| Best HMM Match : ARID (HMM E-Value=4e-35) Length = 1338 Score = 29.9 bits (64), Expect = 1.3 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = +1 Query: 304 EKIPKEQEKIREFRKKHGSTKVGEVTVD 387 E+I QEKI+E RK +GS K T+D Sbjct: 924 ERIRLLQEKIKEMRKLYGSLKAEVATID 951 >SB_18023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 500 Score = 29.9 bits (64), Expect = 1.3 Identities = 25/82 (30%), Positives = 35/82 (42%) Frame = +1 Query: 247 DSSLRGLSAEQTNLKSILQEKIPKEQEKIREFRKKHGSTKVGEVTVDMMYGGMRGIKGLV 426 +SS GL E L I + + E RE K + G ++ + +GL Sbjct: 124 NSSPAGL--EHCRLMGIAVQYLINEGHNFRESDKICMKYEAGPCLGPVLDDTVLRARGLP 181 Query: 427 WETSVLDADEGIRFRGLSIPEC 492 W+ S D D FRGL+IP C Sbjct: 182 WQAS--DQDVANFFRGLNIPSC 201 >SB_31131| Best HMM Match : Drf_FH1 (HMM E-Value=2.4) Length = 407 Score = 29.9 bits (64), Expect = 1.3 Identities = 11/33 (33%), Positives = 22/33 (66%) Frame = -2 Query: 482 MDRPRKRIPSSASSTEVSQTRPLIPRMPPYIIS 384 M P + + ++A+ TE++ T+PL+P P ++S Sbjct: 118 MPAPTESVVTTATPTEIAVTKPLLPPKPSGLVS 150 >SB_44935| Best HMM Match : SAP (HMM E-Value=1.7e-09) Length = 1487 Score = 29.5 bits (63), Expect = 1.8 Identities = 17/52 (32%), Positives = 28/52 (53%), Gaps = 2/52 (3%) Frame = +1 Query: 238 SDCDSSLRGLSAEQTNLKSILQEKIPKEQEKIREFRKKHGSTK--VGEVTVD 387 SDCD G SAE+TN +I + K +++ HG TK + ++T++ Sbjct: 1100 SDCDGDEEGGSAERTN-SAIGDAVVDGATIKWEHYKRFHGMTKEEIADLTIE 1150 >SB_31629| Best HMM Match : DEAD (HMM E-Value=1.2e-05) Length = 415 Score = 29.5 bits (63), Expect = 1.8 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 46 ELVDPPGCRNS 78 ELVDPPGCRNS Sbjct: 319 ELVDPPGCRNS 329 >SB_17534| Best HMM Match : Merozoite_SPAM (HMM E-Value=0.51) Length = 976 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = +1 Query: 289 KSILQEKIPKEQEKIREFRKKHGSTK 366 K +++EK P E++K E +KKH S K Sbjct: 109 KKVIKEKDPSEKKKDGESKKKHRSEK 134 >SB_19218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 28.3 bits (60), Expect = 4.1 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +1 Query: 25 PAVAAALELVDPPG 66 P VA ALELVDPPG Sbjct: 52 PQVAPALELVDPPG 65 >SB_34113| Best HMM Match : PSD5 (HMM E-Value=3.3) Length = 851 Score = 28.3 bits (60), Expect = 4.1 Identities = 18/69 (26%), Positives = 30/69 (43%) Frame = +1 Query: 259 RGLSAEQTNLKSILQEKIPKEQEKIREFRKKHGSTKVGEVTVDMMYGGMRGIKGLVWETS 438 RG +QTNL+ + + P+E + RK+ +++ T D G + + S Sbjct: 13 RGRRFDQTNLRPMAEVSFPRELQPSEIQRKEASASRESVQTSDSESPAQEGRQSIQTSDS 72 Query: 439 VLDADEGIR 465 A EG R Sbjct: 73 ESPAQEGRR 81 >SB_33564| Best HMM Match : RVT_1 (HMM E-Value=0.1) Length = 2075 Score = 27.9 bits (59), Expect = 5.4 Identities = 18/44 (40%), Positives = 20/44 (45%) Frame = -2 Query: 479 DRPRKRIPSSASSTEVSQTRPLIPRMPPYIISTVTSPTLVEPCF 348 D+P IPS SST S MPP +ST T P P F Sbjct: 789 DQPIPAIPSLMSSTLTSSISTTSTGMPPASLSTPT-PFFTHPGF 831 >SB_57869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 377 Score = 27.5 bits (58), Expect = 7.1 Identities = 12/34 (35%), Positives = 19/34 (55%), Gaps = 4/34 (11%) Frame = +2 Query: 113 TCVCDRSRASCRDLCGSLRS----AALKMALFRI 202 +C C ++ + C LC S+ S AA+ AL R+ Sbjct: 317 SCTCTKASSKCSSLCSSIESFNDKAAVNAALMRL 350 >SB_14918| Best HMM Match : Extensin_2 (HMM E-Value=0.35) Length = 1242 Score = 27.1 bits (57), Expect = 9.4 Identities = 14/42 (33%), Positives = 20/42 (47%) Frame = -2 Query: 449 ASSTEVSQTRPLIPRMPPYIISTVTSPTLVEPCFFRNSRIFS 324 A +T +QTR I Y +S+VT+P P F + S Sbjct: 471 AVTTPTAQTRSAITSPHAYTVSSVTAPAATSPNGFSGPEVNS 512 >SB_3708| Best HMM Match : DUF374 (HMM E-Value=2.2) Length = 498 Score = 27.1 bits (57), Expect = 9.4 Identities = 18/72 (25%), Positives = 33/72 (45%), Gaps = 5/72 (6%) Frame = +1 Query: 187 GSIQDHIFKTRR-IAESMSDCDSSLRGLSAEQTNLKSILQEKIPKEQEKIREFR----KK 351 G +++ F+ ++ SD DS + + ++ +K +E E++R FR K Sbjct: 293 GWVEEETFQAEEGNPDADSDADSFVSASESAALEYDDLIDDKFIRESEQLRMFRQTIIKA 352 Query: 352 HGSTKVGEVTVD 387 GS + EV D Sbjct: 353 AGSHRTAEVGCD 364 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,787,285 Number of Sequences: 59808 Number of extensions: 308413 Number of successful extensions: 2621 Number of sequences better than 10.0: 71 Number of HSP's better than 10.0 without gapping: 2525 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2621 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1172759136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -