BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1063 (440 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 24 0.56 AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 ... 22 3.0 AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory recept... 22 3.0 AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 ... 22 3.0 AM292368-1|CAL23180.2| 387|Tribolium castaneum gustatory recept... 21 3.9 AM292347-1|CAL23159.2| 387|Tribolium castaneum gustatory recept... 21 3.9 AM292334-1|CAL23146.2| 390|Tribolium castaneum gustatory recept... 21 3.9 AM292333-1|CAL23145.2| 316|Tribolium castaneum gustatory recept... 21 3.9 AM292327-1|CAL23139.2| 387|Tribolium castaneum gustatory recept... 21 3.9 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 24.2 bits (50), Expect = 0.56 Identities = 9/17 (52%), Positives = 14/17 (82%) Frame = -1 Query: 356 LLFVLCLFYTKV*VFYL 306 LLF+LC++Y V +F+L Sbjct: 127 LLFLLCIYYFVVPLFFL 143 Score = 21.0 bits (42), Expect = 5.2 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = -1 Query: 356 LLFVLCLFYTKV*VFYLSVEALRSLPGQLVNIYFFY 249 LLF+LC Y V + + + ++ L YF+Y Sbjct: 70 LLFLLCSGYFTVHLLFYCPFIIFTVHFLLCTYYFYY 105 Score = 20.2 bits (40), Expect = 9.1 Identities = 6/9 (66%), Positives = 9/9 (100%) Frame = -1 Query: 356 LLFVLCLFY 330 LLF+LC++Y Sbjct: 279 LLFLLCIYY 287 >AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 505 Score = 21.8 bits (44), Expect = 3.0 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -1 Query: 359 FLLFVLCLFYTKV*VFYLSVEALRSLPGQLVN 264 FLLF L Y + S+ +L LPG VN Sbjct: 14 FLLFYLFYCYKTIKQHIYSLISLSYLPGPPVN 45 >AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory receptor candidate 43 protein. Length = 353 Score = 21.8 bits (44), Expect = 3.0 Identities = 7/19 (36%), Positives = 11/19 (57%) Frame = +1 Query: 382 KEKQNCYFYFKNFPEHFHF 438 K K+ CY+Y+ F H + Sbjct: 109 KTKRYCYYYYAFFGVHLAY 127 >AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q7 protein. Length = 505 Score = 21.8 bits (44), Expect = 3.0 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -1 Query: 359 FLLFVLCLFYTKV*VFYLSVEALRSLPGQLVN 264 FLLF L Y + S+ +L LPG VN Sbjct: 14 FLLFYLFYCYKTIKQHIYSLISLSYLPGPPVN 45 >AM292368-1|CAL23180.2| 387|Tribolium castaneum gustatory receptor candidate 47 protein. Length = 387 Score = 21.4 bits (43), Expect = 3.9 Identities = 8/26 (30%), Positives = 17/26 (65%) Frame = -3 Query: 264 YIFFLLVTKVLNLSSYESWKIIT*KN 187 Y+F+++ T ++ L YE + I+ K+ Sbjct: 92 YVFYVVTTVLVVLVGYERFDILLNKS 117 >AM292347-1|CAL23159.2| 387|Tribolium castaneum gustatory receptor candidate 26 protein. Length = 387 Score = 21.4 bits (43), Expect = 3.9 Identities = 8/26 (30%), Positives = 17/26 (65%) Frame = -3 Query: 264 YIFFLLVTKVLNLSSYESWKIIT*KN 187 Y+F+++ T ++ L YE + I+ K+ Sbjct: 92 YVFYVVTTVLVVLVGYERFDILLNKS 117 >AM292334-1|CAL23146.2| 390|Tribolium castaneum gustatory receptor candidate 13 protein. Length = 390 Score = 21.4 bits (43), Expect = 3.9 Identities = 10/41 (24%), Positives = 21/41 (51%) Frame = -2 Query: 265 IYIFFISYESFELVFI*IMEDNNLKKLIVYSLFYPNRDIMI 143 I++ F+SY + + E K L++ L+Y D+++ Sbjct: 188 IFLMFVSYNIYVCQTVSNFEYFQRKILLMIQLYYLYFDVIV 228 >AM292333-1|CAL23145.2| 316|Tribolium castaneum gustatory receptor candidate 12 protein. Length = 316 Score = 21.4 bits (43), Expect = 3.9 Identities = 10/41 (24%), Positives = 21/41 (51%) Frame = -2 Query: 265 IYIFFISYESFELVFI*IMEDNNLKKLIVYSLFYPNRDIMI 143 I++ F+SY + + E K L++ L+Y D+++ Sbjct: 114 IFLMFVSYNIYVCQTVSNFEYFQRKILLMIQLYYLYFDVIV 154 >AM292327-1|CAL23139.2| 387|Tribolium castaneum gustatory receptor candidate 6 protein. Length = 387 Score = 21.4 bits (43), Expect = 3.9 Identities = 8/26 (30%), Positives = 17/26 (65%) Frame = -3 Query: 264 YIFFLLVTKVLNLSSYESWKIIT*KN 187 Y+F+++ T ++ L YE + I+ K+ Sbjct: 92 YVFYVVTTVLVVLVGYERFDILLNKS 117 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 98,305 Number of Sequences: 336 Number of extensions: 2154 Number of successful extensions: 11 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 9880622 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -