BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1063 (440 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1687.16c |erg3||C-5 sterol desaturase Erg3 |Schizosaccharomy... 27 1.3 SPCC4G3.18 |||conserved fungal family|Schizosaccharomyces pombe|... 27 1.7 SPAP8A3.12c |||tripeptidylpeptidase |Schizosaccharomyces pombe|c... 26 2.2 SPAC823.10c |||mitochondrial carrier with solute carrier repeats... 25 5.2 SPAC521.04c |||calcium permease |Schizosaccharomyces pombe|chr 1... 25 6.8 SPCC1682.16 |rpt4||19S proteasome regulatory subunit Rpt4|Schizo... 24 9.0 >SPAC1687.16c |erg3||C-5 sterol desaturase Erg3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 300 Score = 27.1 bits (57), Expect = 1.3 Identities = 12/28 (42%), Positives = 20/28 (71%), Gaps = 2/28 (7%) Frame = -3 Query: 93 HHSFLKRENFMDVL--IRSLPGQLVLSI 16 H FLK + FM+VL +++LPG +L++ Sbjct: 66 HPKFLKNQVFMEVLTALQNLPGMALLTV 93 >SPCC4G3.18 |||conserved fungal family|Schizosaccharomyces pombe|chr 3|||Manual Length = 828 Score = 26.6 bits (56), Expect = 1.7 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = +2 Query: 215 SYEDKFKTFVTNKKNIYLLADPADFVVPQPINKRPKLLY 331 S+ F+ FV++ +NI + + VVP + K+ +LY Sbjct: 177 SHSPTFRPFVSSIRNICIKILDGEEVVPSSLQKKAAVLY 215 >SPAP8A3.12c |||tripeptidylpeptidase |Schizosaccharomyces pombe|chr 1|||Manual Length = 1274 Score = 26.2 bits (55), Expect = 2.2 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = +1 Query: 346 TNKRNPSDGGPSKEKQNCYFYFKNFPEH 429 +NK P DG K + Y + K FPE+ Sbjct: 63 SNKFYPVDGVVPKHETQAYEFLKKFPEY 90 >SPAC823.10c |||mitochondrial carrier with solute carrier repeats|Schizosaccharomyces pombe|chr 1|||Manual Length = 296 Score = 25.0 bits (52), Expect = 5.2 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +1 Query: 394 NCYFYFKNFPEHF 432 +CYFYF N+ HF Sbjct: 83 SCYFYFLNWLRHF 95 >SPAC521.04c |||calcium permease |Schizosaccharomyces pombe|chr 1|||Manual Length = 881 Score = 24.6 bits (51), Expect = 6.8 Identities = 9/31 (29%), Positives = 16/31 (51%) Frame = -2 Query: 364 TDSFCLFYVYFIQKFRSFIYRLRHYEVCRVS 272 T + C+F ++F+ R+ RH C +S Sbjct: 338 TSAICMFTIFFVPCARTLWAICRHLRTCPLS 368 >SPCC1682.16 |rpt4||19S proteasome regulatory subunit Rpt4|Schizosaccharomyces pombe|chr 3|||Manual Length = 388 Score = 24.2 bits (50), Expect = 9.0 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +2 Query: 290 VVPQPINKRPKLLYKINIKQTKGIRLTG 373 V+ P+ K P+L ++ IK KG+ L G Sbjct: 147 VIELPL-KNPELFLRVGIKPPKGVLLYG 173 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,702,933 Number of Sequences: 5004 Number of extensions: 33654 Number of successful extensions: 75 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 75 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 75 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 160149590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -