BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1063 (440 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_50185| Best HMM Match : CsrA (HMM E-Value=3.9) 32 0.18 SB_9868| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.18 SB_9731| Best HMM Match : Lig_chan (HMM E-Value=3.7e-05) 27 5.2 SB_10690| Best HMM Match : Pkinase (HMM E-Value=6.4e-08) 27 6.9 >SB_50185| Best HMM Match : CsrA (HMM E-Value=3.9) Length = 121 Score = 32.3 bits (70), Expect = 0.18 Identities = 16/55 (29%), Positives = 29/55 (52%) Frame = +2 Query: 212 DSYEDKFKTFVTNKKNIYLLADPADFVVPQPINKRPKLLYKINIKQTKGIRLTGA 376 DS +D+ +TF ++ AD VVPQ +P+++ I ++ KG ++ A Sbjct: 11 DSEDDEIRTFKNSRSPTKSKADHQKPVVPQATAYKPEVINDIRVQVNKGRKMVNA 65 >SB_9868| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 471 Score = 32.3 bits (70), Expect = 0.18 Identities = 16/55 (29%), Positives = 29/55 (52%) Frame = +2 Query: 212 DSYEDKFKTFVTNKKNIYLLADPADFVVPQPINKRPKLLYKINIKQTKGIRLTGA 376 DS +D+ +TF ++ AD VVPQ +P+++ I ++ KG ++ A Sbjct: 154 DSEDDEIRTFKNSRSPTKSKADHQKPVVPQATAYKPEVINDIRVQVNKGRKMVNA 208 >SB_9731| Best HMM Match : Lig_chan (HMM E-Value=3.7e-05) Length = 435 Score = 27.5 bits (58), Expect = 5.2 Identities = 10/36 (27%), Positives = 20/36 (55%) Frame = +2 Query: 305 INKRPKLLYKINIKQTKGIRLTGAHQRKNKIVIFIL 412 + K P YK NI KG+ + ++++V+F++ Sbjct: 216 VKKEPTNKYKYNIPLDKGVSFDSEIKNRSRVVLFLV 251 >SB_10690| Best HMM Match : Pkinase (HMM E-Value=6.4e-08) Length = 865 Score = 27.1 bits (57), Expect = 6.9 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = -2 Query: 214 IMEDNNLKKLIVYSLFYPNRDIMISL 137 I DN L+K V S PN+D+M SL Sbjct: 792 IKPDNILEKTTVLSAINPNKDVMESL 817 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,440,814 Number of Sequences: 59808 Number of extensions: 207115 Number of successful extensions: 342 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 331 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 341 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 859323430 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -