BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1063 (440 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ974168-1|ABJ52808.1| 447|Anopheles gambiae serpin 9 protein. 27 0.30 AY341214-1|AAR13778.1| 260|Anopheles gambiae SRPN9 protein. 27 0.30 AY341213-1|AAR13777.1| 260|Anopheles gambiae SRPN9 protein. 27 0.30 AY341212-1|AAR13776.1| 260|Anopheles gambiae SRPN9 protein. 27 0.30 AY341211-1|AAR13775.1| 260|Anopheles gambiae SRPN9 protein. 27 0.30 AY341210-1|AAR13774.1| 260|Anopheles gambiae SRPN9 protein. 27 0.30 X98186-1|CAA66861.1| 269|Anopheles gambiae put. S3a ribosomal p... 23 6.4 AY391745-1|AAR28995.1| 460|Anopheles gambiae putative GPCR prot... 22 8.4 >DQ974168-1|ABJ52808.1| 447|Anopheles gambiae serpin 9 protein. Length = 447 Score = 27.1 bits (57), Expect = 0.30 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +2 Query: 206 FHDSYEDKFKTFVTNKKNIYLLADPADFV 292 F +++ KFK TNK+ Y+ AD FV Sbjct: 216 FKGTWQTKFKAAETNKEIFYVSADQQKFV 244 >AY341214-1|AAR13778.1| 260|Anopheles gambiae SRPN9 protein. Length = 260 Score = 27.1 bits (57), Expect = 0.30 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +2 Query: 206 FHDSYEDKFKTFVTNKKNIYLLADPADFV 292 F +++ KFK TNK+ Y+ AD FV Sbjct: 90 FKGTWQTKFKAAETNKEIFYVSADQQKFV 118 >AY341213-1|AAR13777.1| 260|Anopheles gambiae SRPN9 protein. Length = 260 Score = 27.1 bits (57), Expect = 0.30 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +2 Query: 206 FHDSYEDKFKTFVTNKKNIYLLADPADFV 292 F +++ KFK TNK+ Y+ AD FV Sbjct: 90 FKGTWQTKFKAAETNKEIFYVSADQQKFV 118 >AY341212-1|AAR13776.1| 260|Anopheles gambiae SRPN9 protein. Length = 260 Score = 27.1 bits (57), Expect = 0.30 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +2 Query: 206 FHDSYEDKFKTFVTNKKNIYLLADPADFV 292 F +++ KFK TNK+ Y+ AD FV Sbjct: 90 FKGTWQTKFKAAETNKEIFYVSADQQKFV 118 >AY341211-1|AAR13775.1| 260|Anopheles gambiae SRPN9 protein. Length = 260 Score = 27.1 bits (57), Expect = 0.30 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +2 Query: 206 FHDSYEDKFKTFVTNKKNIYLLADPADFV 292 F +++ KFK TNK+ Y+ AD FV Sbjct: 90 FKGTWQTKFKAAETNKEIFYVSADQQKFV 118 >AY341210-1|AAR13774.1| 260|Anopheles gambiae SRPN9 protein. Length = 260 Score = 27.1 bits (57), Expect = 0.30 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +2 Query: 206 FHDSYEDKFKTFVTNKKNIYLLADPADFV 292 F +++ KFK TNK+ Y+ AD FV Sbjct: 90 FKGTWQTKFKAAETNKEIFYVSADQQKFV 118 >X98186-1|CAA66861.1| 269|Anopheles gambiae put. S3a ribosomal protein homologue protein. Length = 269 Score = 22.6 bits (46), Expect = 6.4 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -1 Query: 386 SFDGPPSDGFLLFVLCLFYT 327 S D +DGF+L V C+ +T Sbjct: 127 SVDVKTTDGFMLRVFCIGFT 146 >AY391745-1|AAR28995.1| 460|Anopheles gambiae putative GPCR protein. Length = 460 Score = 22.2 bits (45), Expect = 8.4 Identities = 14/57 (24%), Positives = 23/57 (40%) Frame = -2 Query: 352 CLFYVYFIQKFRSFIYRLRHYEVCRVS**IYIFFISYESFELVFI*IMEDNNLKKLI 182 CL ++ + R+F+ Y V Y+FFI+ + I N K +I Sbjct: 333 CLNLPSYVMRVRAFVETGHSYLTILVQYYCYLFFITNFGINFILYCISGQNFRKAVI 389 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 401,666 Number of Sequences: 2352 Number of extensions: 6835 Number of successful extensions: 15 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 36993357 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -