BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1063 (440 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 24 0.85 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 24 0.85 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 21 4.5 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 21 4.5 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 23.8 bits (49), Expect = 0.85 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = +2 Query: 233 KTFVTNKKNIYLLADPADFVVPQPINKRPKLLYK 334 KT+VT +KNIY L + V QP P+L K Sbjct: 29 KTYVTRQKNIYELF----WHVDQPTVYHPELYQK 58 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 23.8 bits (49), Expect = 0.85 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = +2 Query: 233 KTFVTNKKNIYLLADPADFVVPQPINKRPKLLYK 334 KT+VT +KNIY L + V QP P+L K Sbjct: 29 KTYVTRQKNIYELF----WHVDQPTVYHPELYQK 58 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 21.4 bits (43), Expect = 4.5 Identities = 7/23 (30%), Positives = 12/23 (52%) Frame = -2 Query: 394 FVFPLMGPRQTDSFCLFYVYFIQ 326 +VF L+ FCL ++ F + Sbjct: 440 YVFQLLDSYAVSGFCLLFLMFFE 462 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 21.4 bits (43), Expect = 4.5 Identities = 7/23 (30%), Positives = 12/23 (52%) Frame = -2 Query: 394 FVFPLMGPRQTDSFCLFYVYFIQ 326 +VF L+ FCL ++ F + Sbjct: 493 YVFQLLDSYAVSGFCLLFLMFFE 515 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 113,395 Number of Sequences: 438 Number of extensions: 2339 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 11450997 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -