BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1061 (473 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. 25 1.8 AY578809-1|AAT07314.1| 358|Anopheles gambiae Sloan-Kettering In... 24 3.1 AY579078-1|AAT81602.1| 425|Anopheles gambiae neuropeptide F rec... 22 9.5 >AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. Length = 1132 Score = 24.6 bits (51), Expect = 1.8 Identities = 15/39 (38%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Frame = +3 Query: 75 VSSIVTTPAPPF-KPKLITASRQGGGTHPRGLTRGPTTS 188 + S TT PP +P + A+ GGG P G TTS Sbjct: 562 IGSGSTTRLPPLHQPFPMLANHAGGGAIPEGQEPTSTTS 600 >AY578809-1|AAT07314.1| 358|Anopheles gambiae Sloan-Kettering Institute proto-oncogeneproduct protein. Length = 358 Score = 23.8 bits (49), Expect = 3.1 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = +1 Query: 97 LPHLSNRNSLLLHGRVVVPTRADSQEVLPLVRKVYSHHSGE 219 L H S + G +V RA++ + L SHH+GE Sbjct: 31 LVHPSKAGAATGPGGAIVVGRAETPDHLASQHHALSHHAGE 71 >AY579078-1|AAT81602.1| 425|Anopheles gambiae neuropeptide F receptor protein. Length = 425 Score = 22.2 bits (45), Expect = 9.5 Identities = 16/51 (31%), Positives = 22/51 (43%) Frame = -2 Query: 298 LFLNKELVHLLYASKPDKYVPVISTELLRSDANTLFLLVVGPLVSPRGWVP 146 L L LV + KP + PV E R T +LL+ L+ W+P Sbjct: 238 LKLKHRLVVGTASGKPGEAKPVRERERGRRMQRTNYLLISIALIFGVSWLP 288 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 554,236 Number of Sequences: 2352 Number of extensions: 11481 Number of successful extensions: 18 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 41670678 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -