BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1060 (467 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.010 SB_22418| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.017 SB_16113| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.029 SB_11588| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.029 SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.039 SB_47774| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.051 SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.068 SB_18780| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.068 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 33 0.089 SB_1002| Best HMM Match : OTCace_N (HMM E-Value=0) 33 0.089 SB_21334| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.089 SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.089 SB_17198| Best HMM Match : HEAT (HMM E-Value=1.8e-15) 33 0.089 SB_10882| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.089 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.12 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 33 0.12 SB_52596| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.12 SB_55260| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.16 SB_32855| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.16 SB_21779| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.16 SB_261| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.16 SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.21 SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.21 SB_46094| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.21 SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.21 SB_4628| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.21 SB_1940| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.21 SB_1863| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.21 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.27 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.27 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.27 SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) 32 0.27 SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) 32 0.27 SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.27 SB_2426| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.27 SB_52722| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.27 SB_47151| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.27 SB_22502| Best HMM Match : FtsL (HMM E-Value=0.0086) 32 0.27 SB_21311| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.27 SB_7708| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.27 SB_6342| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.27 SB_175| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.27 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.36 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.36 SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.36 SB_19108| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.36 SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.36 SB_2903| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.36 SB_53639| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.36 SB_33797| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.36 SB_23253| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.36 SB_19592| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.36 SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.36 SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) 31 0.36 SB_795| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.36 SB_343| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.36 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.48 SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.48 SB_11081| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.48 SB_7837| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.48 SB_55206| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.48 SB_53245| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.48 SB_51374| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.48 SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.48 SB_43468| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.48 SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) 31 0.48 SB_36586| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.48 SB_28515| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.48 SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.48 SB_17014| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.48 SB_5062| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.48 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) 31 0.63 SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_1420| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_58350| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_45805| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_43717| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_38642| Best HMM Match : IF4E (HMM E-Value=9.7e-12) 31 0.63 SB_36834| Best HMM Match : Rap_GAP (HMM E-Value=0.00045) 31 0.63 SB_36738| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_35297| Best HMM Match : CO_deh_flav_C (HMM E-Value=4.8) 31 0.63 SB_34798| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_29318| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_24514| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_14019| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_9536| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_1318| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.83 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.83 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.83 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.83 SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.83 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 30 0.83 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.83 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.83 SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.83 SB_16326| Best HMM Match : Sushi (HMM E-Value=5.4e-18) 30 0.83 SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.83 SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.83 SB_53521| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.83 SB_47576| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.83 SB_41224| Best HMM Match : DUF765 (HMM E-Value=3.5) 30 0.83 SB_38659| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.83 SB_37411| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.83 SB_32750| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.83 SB_32003| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.83 SB_29878| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.83 SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.83 SB_23716| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.83 SB_22214| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.83 SB_21097| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.83 SB_16765| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.83 SB_16314| Best HMM Match : DUF765 (HMM E-Value=3.5) 30 0.83 SB_13084| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.83 SB_12393| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.83 SB_11000| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.83 SB_5222| Best HMM Match : Ras (HMM E-Value=2.9e-09) 30 0.83 SB_3973| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.83 SB_2526| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.83 SB_516| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.83 SB_379| Best HMM Match : ADK (HMM E-Value=3.2e-05) 30 0.83 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 30 1.1 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_19076| Best HMM Match : HECT (HMM E-Value=0) 30 1.1 SB_15961| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_8860| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_7929| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_5250| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_2869| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_56894| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_54339| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_53934| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_53415| Best HMM Match : efhand (HMM E-Value=2.7e-12) 30 1.1 SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_46688| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_46641| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_45361| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_44586| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_44533| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_43349| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_43244| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_43046| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_41735| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_40073| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_36996| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_36119| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_36003| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_34253| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_34241| Best HMM Match : RuvA_C (HMM E-Value=1.5) 30 1.1 SB_33166| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_32763| Best HMM Match : Histone_HNS (HMM E-Value=0.15) 30 1.1 SB_31130| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_30823| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_30669| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_30190| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_28183| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_27866| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_26870| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_25764| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_23292| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_23203| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_23161| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_22083| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_21702| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_17859| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_17747| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_15685| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_15081| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_13994| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_12908| Best HMM Match : Drf_FH1 (HMM E-Value=4.9) 30 1.1 SB_12674| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_10647| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) 30 1.1 SB_9854| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_9445| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_9069| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_6535| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_4378| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.5 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.5 SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.5 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.5 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.5 SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.5 SB_21293| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.5 SB_20039| Best HMM Match : LRR_1 (HMM E-Value=0.0061) 29 1.5 SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.5 SB_17987| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.5 SB_13641| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.5 SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.5 SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.5 SB_8191| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.5 SB_7279| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.5 SB_753| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.5 SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.5 SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.5 SB_55000| Best HMM Match : DUF765 (HMM E-Value=3.9) 29 1.5 SB_52165| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.5 SB_50670| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.5 SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.5 SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.5 SB_44783| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.5 SB_39773| Best HMM Match : DUF765 (HMM E-Value=4.1) 29 1.5 SB_38949| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.5 SB_31086| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.5 SB_30732| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.5 SB_27816| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.5 SB_18776| Best HMM Match : DUF765 (HMM E-Value=4) 29 1.5 SB_15671| Best HMM Match : DUF765 (HMM E-Value=9.6) 29 1.5 SB_14727| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.5 SB_8232| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.5 SB_7555| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.5 SB_6419| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.5 SB_4657| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.5 SB_2671| Best HMM Match : Amidohydro_2 (HMM E-Value=5.6) 29 1.5 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_49546| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 29 1.9 SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87) 29 1.9 SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) 29 1.9 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_21366| Best HMM Match : YL1 (HMM E-Value=6.4) 29 1.9 SB_14529| Best HMM Match : S10_plectin (HMM E-Value=5.8) 29 1.9 SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_56549| Best HMM Match : Spermine_synth (HMM E-Value=1.5e-29) 29 1.9 SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_48897| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_48334| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_48297| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_47610| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_47430| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_46157| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_44611| Best HMM Match : DUF765 (HMM E-Value=2.6) 29 1.9 SB_39260| Best HMM Match : DUF765 (HMM E-Value=9.6) 29 1.9 SB_39012| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_38625| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_38326| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_35028| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_34686| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_29965| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_29704| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_29275| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_26310| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_23941| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_20081| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_18638| Best HMM Match : DUF765 (HMM E-Value=4) 29 1.9 SB_18474| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_17626| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_17005| Best HMM Match : DUF765 (HMM E-Value=7.4) 29 1.9 SB_16436| Best HMM Match : DUF765 (HMM E-Value=9.2) 29 1.9 SB_16044| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_14396| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_14039| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_13763| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_12282| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_9111| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_1736| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_719| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 29 2.5 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 29 2.5 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 29 2.5 SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) 29 2.5 SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_25575| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_23886| Best HMM Match : Adeno_VII (HMM E-Value=8.7) 29 2.5 SB_22864| Best HMM Match : Adeno_VII (HMM E-Value=7.5) 29 2.5 SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_20337| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_13399| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) 29 2.5 SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) 29 2.5 SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_7158| Best HMM Match : Copper-fist (HMM E-Value=7.1) 29 2.5 SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_4586| Best HMM Match : DUF765 (HMM E-Value=7) 29 2.5 SB_2915| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_1239| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_56965| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_56822| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_54383| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_54347| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_52745| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_52392| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_47580| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_46226| Best HMM Match : Ion_trans (HMM E-Value=1.4013e-45) 29 2.5 SB_45961| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_44850| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_43538| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_43466| Best HMM Match : DEAD (HMM E-Value=1.8) 29 2.5 SB_42579| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_42404| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_40987| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_39375| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_38978| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_37939| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_37747| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_37019| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_35112| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_34430| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_32645| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_32567| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_30677| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_30117| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_29960| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_28438| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_27903| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_26199| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_26033| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_25053| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_23700| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_23309| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_21711| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_21233| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_18123| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_16924| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_16330| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_13520| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_9296| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_9177| Best HMM Match : PPI_Ypi1 (HMM E-Value=1.9) 29 2.5 SB_9153| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_8550| Best HMM Match : MASE1 (HMM E-Value=1.5) 29 2.5 SB_5539| Best HMM Match : Plasmodium_HRP (HMM E-Value=0.033) 29 2.5 SB_4147| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_3601| Best HMM Match : DUF765 (HMM E-Value=3.9) 29 2.5 SB_3006| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_2747| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_2222| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_2166| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_1971| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_1746| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_897| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_132| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 28 3.4 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 28 3.4 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 28 3.4 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 28 3.4 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 28 3.4 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 28 3.4 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 28 3.4 SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) 28 3.4 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 28 3.4 SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 28 3.4 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_30021| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_26464| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_24337| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6) 28 3.4 SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) 28 3.4 SB_17701| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_15454| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_15306| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_14523| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_14086| Best HMM Match : POR (HMM E-Value=7.7) 28 3.4 SB_13728| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_13203| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_13008| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_12959| Best HMM Match : Peptidase_M16_C (HMM E-Value=1e-14) 28 3.4 SB_12705| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_12682| Best HMM Match : DUF1336 (HMM E-Value=3.2) 28 3.4 SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_11831| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_10567| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) 28 3.4 SB_8846| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_8545| Best HMM Match : C2 (HMM E-Value=0.00073) 28 3.4 SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_6846| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_6413| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_6345| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_4735| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 >SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 36.7 bits (81), Expect = 0.010 Identities = 15/19 (78%), Positives = 17/19 (89%) Frame = -3 Query: 57 QFVLRASDPCSPGDPLVLE 1 +FVLR S+ CSPGDPLVLE Sbjct: 35 EFVLRVSNSCSPGDPLVLE 53 >SB_22418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 35.9 bits (79), Expect = 0.017 Identities = 16/24 (66%), Positives = 18/24 (75%) Frame = -3 Query: 72 ANVKAQFVLRASDPCSPGDPLVLE 1 AN+ Q L AS+ CSPGDPLVLE Sbjct: 11 ANINTQSKLVASNSCSPGDPLVLE 34 >SB_16113| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 35.1 bits (77), Expect = 0.029 Identities = 14/24 (58%), Positives = 19/24 (79%) Frame = -3 Query: 72 ANVKAQFVLRASDPCSPGDPLVLE 1 AN++ + + AS+ CSPGDPLVLE Sbjct: 11 ANIRLRGICAASNSCSPGDPLVLE 34 >SB_11588| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 35.1 bits (77), Expect = 0.029 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = -3 Query: 63 KAQFVLRASDPCSPGDPLVLE 1 KA V++ S+ CSPGDPLVLE Sbjct: 7 KADLVIKTSNSCSPGDPLVLE 27 >SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 34.7 bits (76), Expect = 0.039 Identities = 14/24 (58%), Positives = 18/24 (75%) Frame = -3 Query: 72 ANVKAQFVLRASDPCSPGDPLVLE 1 AN+ +F + S+ CSPGDPLVLE Sbjct: 11 ANITGEFQWQISNSCSPGDPLVLE 34 >SB_47774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 34.3 bits (75), Expect = 0.051 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = -3 Query: 75 YANVKAQFVLRASDPCSPGDPLVLE 1 Y K Q +R S+ CSPGDPLVLE Sbjct: 8 YIREKLQGYIRESNSCSPGDPLVLE 32 >SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 33.9 bits (74), Expect = 0.068 Identities = 16/42 (38%), Positives = 24/42 (57%) Frame = -3 Query: 126 DILYMTRVQKERLDPSEYANVKAQFVLRASDPCSPGDPLVLE 1 D L + + P++ K+Q + + S+ CSPGDPLVLE Sbjct: 6 DTLISANIDILKWIPADNLCKKSQDISKTSNSCSPGDPLVLE 47 >SB_18780| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 212 Score = 33.9 bits (74), Expect = 0.068 Identities = 13/20 (65%), Positives = 17/20 (85%) Frame = -3 Query: 60 AQFVLRASDPCSPGDPLVLE 1 A F+++ S+ CSPGDPLVLE Sbjct: 82 ALFIIQTSNSCSPGDPLVLE 101 Score = 27.5 bits (58), Expect = 5.9 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +3 Query: 3 LELVDPPGCRD 35 LELVDPPGCR+ Sbjct: 13 LELVDPPGCRN 23 >SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) Length = 130 Score = 33.5 bits (73), Expect = 0.089 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -3 Query: 54 FVLRASDPCSPGDPLVLE 1 F L AS+ CSPGDPLVLE Sbjct: 2 FALSASNSCSPGDPLVLE 19 >SB_1002| Best HMM Match : OTCace_N (HMM E-Value=0) Length = 563 Score = 33.5 bits (73), Expect = 0.089 Identities = 15/34 (44%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Frame = -3 Query: 150 LEEVMAEVDILYMTRVQKERLD-PSEYANVKAQF 52 LEE + + D+LY+TR+Q+ER + EY V F Sbjct: 434 LEEALPDSDVLYVTRIQRERFNTQEEYEQVPTLF 467 >SB_21334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 33.5 bits (73), Expect = 0.089 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 48 LRASDPCSPGDPLVLE 1 LRAS+ CSPGDPLVLE Sbjct: 8 LRASNSCSPGDPLVLE 23 >SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 33.5 bits (73), Expect = 0.089 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -3 Query: 54 FVLRASDPCSPGDPLVLE 1 F++ AS+ CSPGDPLVLE Sbjct: 8 FIMLASNSCSPGDPLVLE 25 >SB_17198| Best HMM Match : HEAT (HMM E-Value=1.8e-15) Length = 802 Score = 33.5 bits (73), Expect = 0.089 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = -3 Query: 84 PSEYANVKAQFVLRASDPCSPGDPLVLE 1 PS A+ V+ S+ CSPGDPLVLE Sbjct: 76 PSPILYCSAECVMTISNSCSPGDPLVLE 103 >SB_10882| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 33.5 bits (73), Expect = 0.089 Identities = 15/34 (44%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Frame = -3 Query: 150 LEEVMAEVDILYMTRVQKERLD-PSEYANVKAQF 52 LEE + + D+LY+TR+Q+ER + EY V F Sbjct: 6 LEEALPDSDVLYVTRIQRERFNTQEEYEQVPTLF 39 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 33.1 bits (72), Expect = 0.12 Identities = 19/43 (44%), Positives = 28/43 (65%), Gaps = 1/43 (2%) Frame = -3 Query: 126 DILYMTRVQKERLDPSEYANVKA-QFVLRASDPCSPGDPLVLE 1 D L ++ ++ D SE A+++A Q + S+ CSPGDPLVLE Sbjct: 6 DTLISANIEGKKPDESE-ADIEAKQRMEYLSNSCSPGDPLVLE 47 >SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) Length = 606 Score = 33.1 bits (72), Expect = 0.12 Identities = 16/36 (44%), Positives = 19/36 (52%) Frame = -3 Query: 108 RVQKERLDPSEYANVKAQFVLRASDPCSPGDPLVLE 1 R ++ LD Y AS+ CSPGDPLVLE Sbjct: 460 RKSQDALDRRRYIQAHPILEAGASNSCSPGDPLVLE 495 >SB_52596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 176 Score = 33.1 bits (72), Expect = 0.12 Identities = 22/56 (39%), Positives = 29/56 (51%) Frame = -3 Query: 168 YFCIFYLEEVMAEVDILYMTRVQKERLDPSEYANVKAQFVLRASDPCSPGDPLVLE 1 +FC ++ V A L K R + + VK+ RAS+ CSPGDPLVLE Sbjct: 12 FFCTSIVKPVAATSIPLLKLDNFKPRPEDKIHKIVKSSS--RASNSCSPGDPLVLE 65 >SB_55260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 32.7 bits (71), Expect = 0.16 Identities = 18/43 (41%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = -3 Query: 126 DILYMTRVQKERLDPSEYANVKAQF-VLRASDPCSPGDPLVLE 1 D L + +E Y V+ Q V+ S+ CSPGDPLVLE Sbjct: 6 DTLISANIDREGQKTIPYPAVRTQKPVIFLSNSCSPGDPLVLE 48 >SB_32855| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 32.7 bits (71), Expect = 0.16 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -3 Query: 51 VLRASDPCSPGDPLVLE 1 +L AS+ CSPGDPLVLE Sbjct: 13 ILHASNSCSPGDPLVLE 29 >SB_21779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 32.7 bits (71), Expect = 0.16 Identities = 13/19 (68%), Positives = 16/19 (84%) Frame = -3 Query: 57 QFVLRASDPCSPGDPLVLE 1 +FV + S+ CSPGDPLVLE Sbjct: 12 KFVSKVSNSCSPGDPLVLE 30 >SB_261| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 32.7 bits (71), Expect = 0.16 Identities = 15/24 (62%), Positives = 19/24 (79%) Frame = -3 Query: 72 ANVKAQFVLRASDPCSPGDPLVLE 1 AN+KA ++S+ CSPGDPLVLE Sbjct: 11 ANIKA-LTNKSSNSCSPGDPLVLE 33 >SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 32.3 bits (70), Expect = 0.21 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = -3 Query: 72 ANVKAQFVLRASDPCSPGDPLVLE 1 AN+ + + S+ CSPGDPLVLE Sbjct: 11 ANILSYLPINESNSCSPGDPLVLE 34 >SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 32.3 bits (70), Expect = 0.21 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = -3 Query: 72 ANVKAQFVLRASDPCSPGDPLVLE 1 AN+ + + S+ CSPGDPLVLE Sbjct: 11 ANIPHELLAPTSNSCSPGDPLVLE 34 >SB_46094| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 32.3 bits (70), Expect = 0.21 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = -3 Query: 54 FVLRASDPCSPGDPLVLE 1 F++ S+ CSPGDPLVLE Sbjct: 58 FIITTSNSCSPGDPLVLE 75 >SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 32.3 bits (70), Expect = 0.21 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -3 Query: 51 VLRASDPCSPGDPLVLE 1 +LR S+ CSPGDPLVLE Sbjct: 6 MLRVSNSCSPGDPLVLE 22 >SB_4628| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 32.3 bits (70), Expect = 0.21 Identities = 16/31 (51%), Positives = 21/31 (67%) Frame = -3 Query: 93 RLDPSEYANVKAQFVLRASDPCSPGDPLVLE 1 RL P+++ +V L S+ CSPGDPLVLE Sbjct: 3 RLIPNKFYSVSVWLAL--SNSCSPGDPLVLE 31 >SB_1940| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 32.3 bits (70), Expect = 0.21 Identities = 15/32 (46%), Positives = 22/32 (68%), Gaps = 2/32 (6%) Frame = -3 Query: 90 LDPSEYAN--VKAQFVLRASDPCSPGDPLVLE 1 +DP E + + A+ ++ S+ CSPGDPLVLE Sbjct: 51 VDPREVVHHIISAETMVIESNSCSPGDPLVLE 82 >SB_1863| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 32.3 bits (70), Expect = 0.21 Identities = 14/23 (60%), Positives = 16/23 (69%) Frame = -3 Query: 69 NVKAQFVLRASDPCSPGDPLVLE 1 N Q +L S+ CSPGDPLVLE Sbjct: 3 NQSKQCLLEISNSCSPGDPLVLE 25 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 31.9 bits (69), Expect = 0.27 Identities = 14/20 (70%), Positives = 15/20 (75%) Frame = -3 Query: 60 AQFVLRASDPCSPGDPLVLE 1 A V R S+ CSPGDPLVLE Sbjct: 20 ASLVPRPSNSCSPGDPLVLE 39 >SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 31.9 bits (69), Expect = 0.27 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -3 Query: 45 RASDPCSPGDPLVLE 1 RAS+ CSPGDPLVLE Sbjct: 22 RASNSCSPGDPLVLE 36 >SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 31.9 bits (69), Expect = 0.27 Identities = 13/22 (59%), Positives = 15/22 (68%) Frame = -3 Query: 66 VKAQFVLRASDPCSPGDPLVLE 1 + A R S+ CSPGDPLVLE Sbjct: 9 ISANITWRPSNSCSPGDPLVLE 30 >SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) Length = 137 Score = 31.9 bits (69), Expect = 0.27 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -3 Query: 51 VLRASDPCSPGDPLVLE 1 VL +S+ CSPGDPLVLE Sbjct: 11 VLNSSNSCSPGDPLVLE 27 >SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) Length = 176 Score = 31.9 bits (69), Expect = 0.27 Identities = 13/36 (36%), Positives = 22/36 (61%) Frame = -3 Query: 108 RVQKERLDPSEYANVKAQFVLRASDPCSPGDPLVLE 1 + +K ++ + ++ +V S+ CSPGDPLVLE Sbjct: 30 KCEKNKVGDEYHTLMECDYVNDISNSCSPGDPLVLE 65 >SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 31.9 bits (69), Expect = 0.27 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -3 Query: 45 RASDPCSPGDPLVLE 1 RAS+ CSPGDPLVLE Sbjct: 9 RASNSCSPGDPLVLE 23 >SB_2426| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 31.9 bits (69), Expect = 0.27 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = -3 Query: 51 VLRASDPCSPGDPLVLE 1 ++R S+ CSPGDPLVLE Sbjct: 21 IIRQSNSCSPGDPLVLE 37 >SB_52722| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 31.9 bits (69), Expect = 0.27 Identities = 13/22 (59%), Positives = 15/22 (68%) Frame = -3 Query: 66 VKAQFVLRASDPCSPGDPLVLE 1 +K F S+ CSPGDPLVLE Sbjct: 3 IKVGFTCALSNSCSPGDPLVLE 24 >SB_47151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 31.9 bits (69), Expect = 0.27 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -3 Query: 45 RASDPCSPGDPLVLE 1 RAS+ CSPGDPLVLE Sbjct: 13 RASNSCSPGDPLVLE 27 >SB_22502| Best HMM Match : FtsL (HMM E-Value=0.0086) Length = 167 Score = 31.9 bits (69), Expect = 0.27 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -3 Query: 51 VLRASDPCSPGDPLVLE 1 +L AS+ CSPGDPLVLE Sbjct: 40 LLNASNSCSPGDPLVLE 56 >SB_21311| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 31.9 bits (69), Expect = 0.27 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -3 Query: 45 RASDPCSPGDPLVLE 1 RAS+ CSPGDPLVLE Sbjct: 18 RASNSCSPGDPLVLE 32 >SB_7708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 31.9 bits (69), Expect = 0.27 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -3 Query: 45 RASDPCSPGDPLVLE 1 RAS+ CSPGDPLVLE Sbjct: 4 RASNSCSPGDPLVLE 18 >SB_6342| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 31.9 bits (69), Expect = 0.27 Identities = 15/31 (48%), Positives = 23/31 (74%) Frame = -3 Query: 93 RLDPSEYANVKAQFVLRASDPCSPGDPLVLE 1 +L SE+ +K++ ++S+ CSPGDPLVLE Sbjct: 13 KLQYSEHI-IKSRCSCQSSNSCSPGDPLVLE 42 >SB_175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 31.9 bits (69), Expect = 0.27 Identities = 12/22 (54%), Positives = 16/22 (72%) Frame = -3 Query: 66 VKAQFVLRASDPCSPGDPLVLE 1 + A ++ S+ CSPGDPLVLE Sbjct: 9 ISANIIVYTSNSCSPGDPLVLE 30 >SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 31.5 bits (68), Expect = 0.36 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -3 Query: 51 VLRASDPCSPGDPLVLE 1 +L AS+ CSPGDPLVLE Sbjct: 27 LLTASNSCSPGDPLVLE 43 >SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 31.5 bits (68), Expect = 0.36 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -3 Query: 72 ANVKAQFVLRASDPCSPGDPLVLE 1 AN+K + AS+ CSPGDPLVLE Sbjct: 11 ANIKGRHC--ASNSCSPGDPLVLE 32 >SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 31.5 bits (68), Expect = 0.36 Identities = 14/24 (58%), Positives = 17/24 (70%) Frame = -3 Query: 72 ANVKAQFVLRASDPCSPGDPLVLE 1 AN+ +L S+ CSPGDPLVLE Sbjct: 11 ANIPKLKLLITSNSCSPGDPLVLE 34 >SB_19108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 31.5 bits (68), Expect = 0.36 Identities = 18/37 (48%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = -3 Query: 108 RVQKERLDPS-EYANVKAQFVLRASDPCSPGDPLVLE 1 +V +RL P E VK S+ CSPGDPLVLE Sbjct: 19 KVYDKRLRPHFEGDPVKVSISFFLSNSCSPGDPLVLE 55 >SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 31.5 bits (68), Expect = 0.36 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = -3 Query: 75 YANVKAQFVLRASDPCSPGDPLVLE 1 Y+N F R S+ CSPGDPLVLE Sbjct: 23 YSNSTPHF--RVSNSCSPGDPLVLE 45 >SB_2903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 31.5 bits (68), Expect = 0.36 Identities = 16/36 (44%), Positives = 20/36 (55%) Frame = -2 Query: 109 PRAKRASGPVRVRQRESAVCSSRQRSLQPGGSTSSR 2 P + R SG +V + +C LQPGGSTSSR Sbjct: 14 PGSSRVSGCCKVYLNVNVLCPVLIEFLQPGGSTSSR 49 >SB_53639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 31.5 bits (68), Expect = 0.36 Identities = 15/28 (53%), Positives = 20/28 (71%), Gaps = 4/28 (14%) Frame = -3 Query: 72 ANVKAQF----VLRASDPCSPGDPLVLE 1 AN++ +F +R S+ CSPGDPLVLE Sbjct: 11 ANIEKRFRVIIAVRRSNSCSPGDPLVLE 38 >SB_33797| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 31.5 bits (68), Expect = 0.36 Identities = 14/25 (56%), Positives = 17/25 (68%) Frame = -3 Query: 75 YANVKAQFVLRASDPCSPGDPLVLE 1 Y + K Q + S+ CSPGDPLVLE Sbjct: 20 YKSSKRQGGVTGSNSCSPGDPLVLE 44 >SB_23253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 31.5 bits (68), Expect = 0.36 Identities = 12/16 (75%), Positives = 15/16 (93%) Frame = -3 Query: 48 LRASDPCSPGDPLVLE 1 ++AS+ CSPGDPLVLE Sbjct: 37 IKASNSCSPGDPLVLE 52 >SB_19592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 31.5 bits (68), Expect = 0.36 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = -3 Query: 54 FVLRASDPCSPGDPLVLE 1 ++L S+ CSPGDPLVLE Sbjct: 9 YILDTSNSCSPGDPLVLE 26 >SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 31.5 bits (68), Expect = 0.36 Identities = 13/22 (59%), Positives = 15/22 (68%) Frame = -3 Query: 66 VKAQFVLRASDPCSPGDPLVLE 1 + A V S+ CSPGDPLVLE Sbjct: 9 ISANIVFLISNSCSPGDPLVLE 30 >SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) Length = 221 Score = 31.5 bits (68), Expect = 0.36 Identities = 16/30 (53%), Positives = 20/30 (66%) Frame = -3 Query: 90 LDPSEYANVKAQFVLRASDPCSPGDPLVLE 1 + PS Y + + L AS+ CSPGDPLVLE Sbjct: 82 IGPSIYGHEDIKRAL-ASNSCSPGDPLVLE 110 >SB_795| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 31.5 bits (68), Expect = 0.36 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = -3 Query: 54 FVLRASDPCSPGDPLVLE 1 ++ AS+ CSPGDPLVLE Sbjct: 4 YIFYASNSCSPGDPLVLE 21 >SB_343| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 31.5 bits (68), Expect = 0.36 Identities = 12/19 (63%), Positives = 16/19 (84%) Frame = -3 Query: 57 QFVLRASDPCSPGDPLVLE 1 ++V+ S+ CSPGDPLVLE Sbjct: 66 RYVMTPSNSCSPGDPLVLE 84 >SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 31.1 bits (67), Expect = 0.48 Identities = 15/28 (53%), Positives = 17/28 (60%) Frame = -3 Query: 84 PSEYANVKAQFVLRASDPCSPGDPLVLE 1 P A V+ V S+ CSPGDPLVLE Sbjct: 9 PFPLAAVERPSVASQSNSCSPGDPLVLE 36 >SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 31.1 bits (67), Expect = 0.48 Identities = 13/22 (59%), Positives = 16/22 (72%) Frame = -3 Query: 66 VKAQFVLRASDPCSPGDPLVLE 1 V + F + S+ CSPGDPLVLE Sbjct: 4 VNSNFWIVTSNSCSPGDPLVLE 25 >SB_11081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 226 Score = 31.1 bits (67), Expect = 0.48 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -3 Query: 48 LRASDPCSPGDPLVLE 1 +R S+ CSPGDPLVLE Sbjct: 100 IRTSNSCSPGDPLVLE 115 >SB_7837| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 31.1 bits (67), Expect = 0.48 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = -3 Query: 54 FVLRASDPCSPGDPLVLE 1 F L S+ CSPGDPLVLE Sbjct: 3 FNLNGSNSCSPGDPLVLE 20 >SB_55206| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 31.1 bits (67), Expect = 0.48 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -3 Query: 48 LRASDPCSPGDPLVLE 1 L AS+ CSPGDPLVLE Sbjct: 4 LTASNSCSPGDPLVLE 19 >SB_53245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 31.1 bits (67), Expect = 0.48 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = -3 Query: 72 ANVKAQFVLRASDPCSPGDPLVLE 1 AN+ + S+ CSPGDPLVLE Sbjct: 11 ANITIDIDHKGSNSCSPGDPLVLE 34 >SB_51374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 31.1 bits (67), Expect = 0.48 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = -3 Query: 51 VLRASDPCSPGDPLVLE 1 V++ S+ CSPGDPLVLE Sbjct: 6 VIQGSNSCSPGDPLVLE 22 >SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 31.1 bits (67), Expect = 0.48 Identities = 13/23 (56%), Positives = 17/23 (73%) Frame = -3 Query: 69 NVKAQFVLRASDPCSPGDPLVLE 1 ++ Q + AS+ CSPGDPLVLE Sbjct: 9 SIFCQMEVLASNSCSPGDPLVLE 31 >SB_43468| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 31.1 bits (67), Expect = 0.48 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -3 Query: 48 LRASDPCSPGDPLVLE 1 L AS+ CSPGDPLVLE Sbjct: 17 LTASNSCSPGDPLVLE 32 >SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) Length = 190 Score = 31.1 bits (67), Expect = 0.48 Identities = 14/23 (60%), Positives = 16/23 (69%) Frame = -3 Query: 69 NVKAQFVLRASDPCSPGDPLVLE 1 N+ A V S+ CSPGDPLVLE Sbjct: 57 NLLALTVFMLSNSCSPGDPLVLE 79 >SB_36586| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 31.1 bits (67), Expect = 0.48 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -3 Query: 48 LRASDPCSPGDPLVLE 1 +R S+ CSPGDPLVLE Sbjct: 9 IRTSNSCSPGDPLVLE 24 >SB_28515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 31.1 bits (67), Expect = 0.48 Identities = 16/28 (57%), Positives = 19/28 (67%), Gaps = 2/28 (7%) Frame = -3 Query: 78 EYANVKAQFVLR--ASDPCSPGDPLVLE 1 E AN A+ V + S+ CSPGDPLVLE Sbjct: 16 EKANDNARIVTKFGVSNSCSPGDPLVLE 43 >SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 31.1 bits (67), Expect = 0.48 Identities = 14/22 (63%), Positives = 16/22 (72%) Frame = -3 Query: 66 VKAQFVLRASDPCSPGDPLVLE 1 V A +L S+ CSPGDPLVLE Sbjct: 81 VDASNLLLTSNSCSPGDPLVLE 102 >SB_17014| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 31.1 bits (67), Expect = 0.48 Identities = 13/23 (56%), Positives = 17/23 (73%) Frame = -3 Query: 69 NVKAQFVLRASDPCSPGDPLVLE 1 N++ L+ S+ CSPGDPLVLE Sbjct: 6 NLEGSRRLQTSNSCSPGDPLVLE 28 >SB_5062| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 31.1 bits (67), Expect = 0.48 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = -3 Query: 51 VLRASDPCSPGDPLVLE 1 ++R S+ CSPGDPLVLE Sbjct: 11 LIRLSNSCSPGDPLVLE 27 >SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 30.7 bits (66), Expect = 0.63 Identities = 15/42 (35%), Positives = 25/42 (59%), Gaps = 4/42 (9%) Frame = -3 Query: 114 MTRVQKERLDPSEYANVKAQFVLR----ASDPCSPGDPLVLE 1 +T + ++ S + +++ F+ AS+ CSPGDPLVLE Sbjct: 25 VTSILNPKVSDSTHVHLEPAFLAEGFRVASNSCSPGDPLVLE 66 >SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 30.7 bits (66), Expect = 0.63 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = -3 Query: 60 AQFVLRASDPCSPGDPLVLE 1 A V + S+ CSPGDPLVLE Sbjct: 10 ASIVQQISNSCSPGDPLVLE 29 >SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) Length = 725 Score = 30.7 bits (66), Expect = 0.63 Identities = 19/43 (44%), Positives = 25/43 (58%) Frame = -3 Query: 129 VDILYMTRVQKERLDPSEYANVKAQFVLRASDPCSPGDPLVLE 1 +D+L +T +Q DPS K +S+ CSPGDPLVLE Sbjct: 165 IDVL-LTSLQWIAEDPSSAIQRKQPAC--SSNSCSPGDPLVLE 204 >SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 30.7 bits (66), Expect = 0.63 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -3 Query: 48 LRASDPCSPGDPLVLE 1 +R S+ CSPGDPLVLE Sbjct: 1 MRRSNSCSPGDPLVLE 16 >SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 30.7 bits (66), Expect = 0.63 Identities = 14/25 (56%), Positives = 18/25 (72%), Gaps = 1/25 (4%) Frame = -3 Query: 72 ANVKAQFV-LRASDPCSPGDPLVLE 1 AN++ + R S+ CSPGDPLVLE Sbjct: 11 ANIRRPTIQARKSNSCSPGDPLVLE 35 >SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 30.7 bits (66), Expect = 0.63 Identities = 16/42 (38%), Positives = 22/42 (52%) Frame = -3 Query: 126 DILYMTRVQKERLDPSEYANVKAQFVLRASDPCSPGDPLVLE 1 D L R+ + L + + Q + S+ CSPGDPLVLE Sbjct: 6 DTLGYVRLAVKALQLAVSWQILLQVGFKVSNSCSPGDPLVLE 47 >SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 30.7 bits (66), Expect = 0.63 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -3 Query: 48 LRASDPCSPGDPLVLE 1 L AS+ CSPGDPLVLE Sbjct: 4 LLASNSCSPGDPLVLE 19 >SB_1420| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 30.7 bits (66), Expect = 0.63 Identities = 12/15 (80%), Positives = 14/15 (93%) Frame = -3 Query: 45 RASDPCSPGDPLVLE 1 +AS+ CSPGDPLVLE Sbjct: 13 KASNSCSPGDPLVLE 27 >SB_58350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 30.7 bits (66), Expect = 0.63 Identities = 15/25 (60%), Positives = 19/25 (76%), Gaps = 1/25 (4%) Frame = -3 Query: 72 ANVKAQF-VLRASDPCSPGDPLVLE 1 AN++A V+ S+ CSPGDPLVLE Sbjct: 11 ANIQAIVQVIYPSNSCSPGDPLVLE 35 >SB_45805| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 30.7 bits (66), Expect = 0.63 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = +3 Query: 3 LELVDPPGCRDRWREEQTALSRWRTR 80 LELVDPPGCR+ + Q W R Sbjct: 13 LELVDPPGCRNSIKYGQEEFQIWTRR 38 >SB_43717| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 30.7 bits (66), Expect = 0.63 Identities = 12/16 (75%), Positives = 15/16 (93%) Frame = -3 Query: 48 LRASDPCSPGDPLVLE 1 ++AS+ CSPGDPLVLE Sbjct: 4 VQASNSCSPGDPLVLE 19 >SB_38642| Best HMM Match : IF4E (HMM E-Value=9.7e-12) Length = 263 Score = 30.7 bits (66), Expect = 0.63 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = -3 Query: 63 KAQFVLRASDPCSPGDPLVLE 1 + F L S+ CSPGDPLVLE Sbjct: 132 RLMFHLPGSNSCSPGDPLVLE 152 >SB_36834| Best HMM Match : Rap_GAP (HMM E-Value=0.00045) Length = 545 Score = 30.7 bits (66), Expect = 0.63 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -3 Query: 48 LRASDPCSPGDPLVLE 1 + AS+ CSPGDPLVLE Sbjct: 250 INASNSCSPGDPLVLE 265 >SB_36738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 30.7 bits (66), Expect = 0.63 Identities = 12/15 (80%), Positives = 14/15 (93%) Frame = -3 Query: 45 RASDPCSPGDPLVLE 1 R+S+ CSPGDPLVLE Sbjct: 5 RSSNSCSPGDPLVLE 19 >SB_35297| Best HMM Match : CO_deh_flav_C (HMM E-Value=4.8) Length = 351 Score = 30.7 bits (66), Expect = 0.63 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = -3 Query: 51 VLRASDPCSPGDPLVLE 1 +L +S+ CSPGDPLVLE Sbjct: 224 LLESSNSCSPGDPLVLE 240 >SB_34798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 30.7 bits (66), Expect = 0.63 Identities = 12/15 (80%), Positives = 14/15 (93%) Frame = -3 Query: 45 RASDPCSPGDPLVLE 1 +AS+ CSPGDPLVLE Sbjct: 12 KASNSCSPGDPLVLE 26 >SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 30.7 bits (66), Expect = 0.63 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -3 Query: 48 LRASDPCSPGDPLVLE 1 L+ S+ CSPGDPLVLE Sbjct: 16 LKVSNSCSPGDPLVLE 31 >SB_29318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 30.7 bits (66), Expect = 0.63 Identities = 16/24 (66%), Positives = 18/24 (75%) Frame = -3 Query: 72 ANVKAQFVLRASDPCSPGDPLVLE 1 A V+ Q V AS+ CSPGDPLVLE Sbjct: 15 APVERQHVA-ASNSCSPGDPLVLE 37 >SB_24514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 402 Score = 30.7 bits (66), Expect = 0.63 Identities = 13/19 (68%), Positives = 15/19 (78%) Frame = -3 Query: 57 QFVLRASDPCSPGDPLVLE 1 Q+ L S+ CSPGDPLVLE Sbjct: 166 QYELFLSNSCSPGDPLVLE 184 >SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 30.7 bits (66), Expect = 0.63 Identities = 15/25 (60%), Positives = 18/25 (72%), Gaps = 1/25 (4%) Frame = -3 Query: 72 ANVKAQFVL-RASDPCSPGDPLVLE 1 AN+ +F L S+ CSPGDPLVLE Sbjct: 11 ANIAPRFPLFLISNSCSPGDPLVLE 35 >SB_14019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 30.7 bits (66), Expect = 0.63 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = -3 Query: 51 VLRASDPCSPGDPLVLE 1 +L S+ CSPGDPLVLE Sbjct: 13 ILAGSNSCSPGDPLVLE 29 >SB_9536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 30.7 bits (66), Expect = 0.63 Identities = 12/15 (80%), Positives = 14/15 (93%) Frame = -3 Query: 45 RASDPCSPGDPLVLE 1 +AS+ CSPGDPLVLE Sbjct: 4 KASNSCSPGDPLVLE 18 >SB_1318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 30.7 bits (66), Expect = 0.63 Identities = 12/15 (80%), Positives = 14/15 (93%) Frame = -3 Query: 45 RASDPCSPGDPLVLE 1 +AS+ CSPGDPLVLE Sbjct: 5 KASNSCSPGDPLVLE 19 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 30.3 bits (65), Expect = 0.83 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -3 Query: 48 LRASDPCSPGDPLVLE 1 L+ S+ CSPGDPLVLE Sbjct: 99 LKISNSCSPGDPLVLE 114 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 30.3 bits (65), Expect = 0.83 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = -3 Query: 45 RASDPCSPGDPLVLE 1 R S+ CSPGDPLVLE Sbjct: 6 RVSNSCSPGDPLVLE 20 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 30.3 bits (65), Expect = 0.83 Identities = 13/17 (76%), Positives = 14/17 (82%) Frame = -3 Query: 51 VLRASDPCSPGDPLVLE 1 VL S+ CSPGDPLVLE Sbjct: 7 VLFVSNSCSPGDPLVLE 23 >SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 30.3 bits (65), Expect = 0.83 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -3 Query: 48 LRASDPCSPGDPLVLE 1 + AS+ CSPGDPLVLE Sbjct: 32 VHASNSCSPGDPLVLE 47 >SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 30.3 bits (65), Expect = 0.83 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = -3 Query: 51 VLRASDPCSPGDPLVLE 1 ++ S+ CSPGDPLVLE Sbjct: 4 IMETSNSCSPGDPLVLE 20 >SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) Length = 1016 Score = 30.3 bits (65), Expect = 0.83 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = -3 Query: 54 FVLRASDPCSPGDPLVLE 1 F L S+ CSPGDPLVLE Sbjct: 888 FPLVTSNSCSPGDPLVLE 905 >SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 30.3 bits (65), Expect = 0.83 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = -3 Query: 45 RASDPCSPGDPLVLE 1 R S+ CSPGDPLVLE Sbjct: 39 RGSNSCSPGDPLVLE 53 >SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 30.3 bits (65), Expect = 0.83 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = -3 Query: 90 LDPSEYANVKAQFVLRASDPCSPGDPLVLE 1 LD +++ F+ S+ CSPGDPLVLE Sbjct: 22 LDDVFVRDIRILFLDLISNSCSPGDPLVLE 51 >SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 308 Score = 30.3 bits (65), Expect = 0.83 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = -3 Query: 45 RASDPCSPGDPLVLE 1 R S+ CSPGDPLVLE Sbjct: 183 RVSNSCSPGDPLVLE 197 >SB_16326| Best HMM Match : Sushi (HMM E-Value=5.4e-18) Length = 258 Score = 30.3 bits (65), Expect = 0.83 Identities = 14/23 (60%), Positives = 18/23 (78%) Frame = -3 Query: 69 NVKAQFVLRASDPCSPGDPLVLE 1 N++A+ V S+ CSPGDPLVLE Sbjct: 127 NLRARIV--GSNSCSPGDPLVLE 147 >SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 447 Score = 30.3 bits (65), Expect = 0.83 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = -3 Query: 51 VLRASDPCSPGDPLVLE 1 +L S+ CSPGDPLVLE Sbjct: 76 ILLTSNSCSPGDPLVLE 92 >SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 30.3 bits (65), Expect = 0.83 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = -3 Query: 51 VLRASDPCSPGDPLVLE 1 V++ S+ CSPGDPLVLE Sbjct: 68 VVQKSNSCSPGDPLVLE 84 >SB_53521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 30.3 bits (65), Expect = 0.83 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = -3 Query: 45 RASDPCSPGDPLVLE 1 R S+ CSPGDPLVLE Sbjct: 6 RTSNSCSPGDPLVLE 20 >SB_47576| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 896 Score = 30.3 bits (65), Expect = 0.83 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = -3 Query: 69 NVKAQFVLRASDPCSPGDPLVLE 1 N+ ++ S+ CSPGDPLVLE Sbjct: 536 NIDRAVQIQESNSCSPGDPLVLE 558 >SB_41224| Best HMM Match : DUF765 (HMM E-Value=3.5) Length = 126 Score = 30.3 bits (65), Expect = 0.83 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -3 Query: 48 LRASDPCSPGDPLVLE 1 + AS+ CSPGDPLVLE Sbjct: 1 MAASNSCSPGDPLVLE 16 >SB_38659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 30.3 bits (65), Expect = 0.83 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = -3 Query: 45 RASDPCSPGDPLVLE 1 R S+ CSPGDPLVLE Sbjct: 3 RVSNSCSPGDPLVLE 17 >SB_37411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 30.3 bits (65), Expect = 0.83 Identities = 13/17 (76%), Positives = 14/17 (82%) Frame = -3 Query: 51 VLRASDPCSPGDPLVLE 1 VL S+ CSPGDPLVLE Sbjct: 2 VLGISNSCSPGDPLVLE 18 >SB_32750| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 30.3 bits (65), Expect = 0.83 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = -3 Query: 90 LDPSEYANVKAQFVLRASDPCSPGDPLVLE 1 +DP + V+ S+ CSPGDPLVLE Sbjct: 10 VDPRNAELMVVTEVIITSNSCSPGDPLVLE 39 >SB_32003| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 30.3 bits (65), Expect = 0.83 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = -3 Query: 45 RASDPCSPGDPLVLE 1 R S+ CSPGDPLVLE Sbjct: 11 RTSNSCSPGDPLVLE 25 >SB_29878| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 30.3 bits (65), Expect = 0.83 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -3 Query: 48 LRASDPCSPGDPLVLE 1 L +S+ CSPGDPLVLE Sbjct: 4 LHSSNSCSPGDPLVLE 19 >SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 30.3 bits (65), Expect = 0.83 Identities = 15/28 (53%), Positives = 19/28 (67%) Frame = -3 Query: 84 PSEYANVKAQFVLRASDPCSPGDPLVLE 1 P+ YA + + L S+ CSPGDPLVLE Sbjct: 14 PTRYAILSPRARL-VSNSCSPGDPLVLE 40 >SB_23716| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 30.3 bits (65), Expect = 0.83 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -3 Query: 48 LRASDPCSPGDPLVLE 1 + AS+ CSPGDPLVLE Sbjct: 4 ISASNSCSPGDPLVLE 19 >SB_22214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 30.3 bits (65), Expect = 0.83 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = -3 Query: 45 RASDPCSPGDPLVLE 1 R S+ CSPGDPLVLE Sbjct: 25 RGSNSCSPGDPLVLE 39 >SB_21097| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 30.3 bits (65), Expect = 0.83 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = -3 Query: 78 EYANVKAQFVLRASDPCSPGDPLVLE 1 E ++++ + S+ CSPGDPLVLE Sbjct: 52 EVIHLRSLYFPETSNSCSPGDPLVLE 77 >SB_16765| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 30.3 bits (65), Expect = 0.83 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = -3 Query: 45 RASDPCSPGDPLVLE 1 R S+ CSPGDPLVLE Sbjct: 10 RGSNSCSPGDPLVLE 24 >SB_16314| Best HMM Match : DUF765 (HMM E-Value=3.5) Length = 127 Score = 30.3 bits (65), Expect = 0.83 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -3 Query: 48 LRASDPCSPGDPLVLE 1 + AS+ CSPGDPLVLE Sbjct: 1 MAASNSCSPGDPLVLE 16 >SB_13084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 30.3 bits (65), Expect = 0.83 Identities = 13/17 (76%), Positives = 14/17 (82%) Frame = -3 Query: 51 VLRASDPCSPGDPLVLE 1 V AS+ CSPGDPLVLE Sbjct: 9 VYLASNSCSPGDPLVLE 25 >SB_12393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 30.3 bits (65), Expect = 0.83 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -3 Query: 48 LRASDPCSPGDPLVLE 1 L +S+ CSPGDPLVLE Sbjct: 9 LESSNSCSPGDPLVLE 24 >SB_11000| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 30.3 bits (65), Expect = 0.83 Identities = 12/15 (80%), Positives = 14/15 (93%) Frame = -3 Query: 45 RASDPCSPGDPLVLE 1 +AS+ CSPGDPLVLE Sbjct: 6 QASNSCSPGDPLVLE 20 >SB_5222| Best HMM Match : Ras (HMM E-Value=2.9e-09) Length = 181 Score = 30.3 bits (65), Expect = 0.83 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = -3 Query: 45 RASDPCSPGDPLVLE 1 R S+ CSPGDPLVLE Sbjct: 70 RGSNSCSPGDPLVLE 84 >SB_3973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 30.3 bits (65), Expect = 0.83 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = -3 Query: 54 FVLRASDPCSPGDPLVLE 1 FV+R S+ CSPGDPLVLE Sbjct: 2 FVVR-SNSCSPGDPLVLE 18 >SB_2526| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 30.3 bits (65), Expect = 0.83 Identities = 16/43 (37%), Positives = 23/43 (53%) Frame = -3 Query: 129 VDILYMTRVQKERLDPSEYANVKAQFVLRASDPCSPGDPLVLE 1 VDI++ V + L+ + + S+ CSPGDPLVLE Sbjct: 17 VDIVWNVCVTRRILEAPSEVELYLD-ICHTSNSCSPGDPLVLE 58 >SB_516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 30.3 bits (65), Expect = 0.83 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = -3 Query: 54 FVLRASDPCSPGDPLVLE 1 F+ S+ CSPGDPLVLE Sbjct: 6 FINSVSNSCSPGDPLVLE 23 >SB_379| Best HMM Match : ADK (HMM E-Value=3.2e-05) Length = 991 Score = 30.3 bits (65), Expect = 0.83 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = -3 Query: 54 FVLRASDPCSPGDPLVLE 1 F AS+ CSPGDPLVLE Sbjct: 532 FFGNASNSCSPGDPLVLE 549 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -3 Query: 42 ASDPCSPGDPLVLE 1 AS+ CSPGDPLVLE Sbjct: 14 ASNSCSPGDPLVLE 27 >SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -3 Query: 42 ASDPCSPGDPLVLE 1 AS+ CSPGDPLVLE Sbjct: 6 ASNSCSPGDPLVLE 19 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = -3 Query: 45 RASDPCSPGDPLVLE 1 R S+ CSPGDPLVLE Sbjct: 380 RRSNSCSPGDPLVLE 394 >SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -3 Query: 42 ASDPCSPGDPLVLE 1 AS+ CSPGDPLVLE Sbjct: 2 ASNSCSPGDPLVLE 15 >SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -3 Query: 42 ASDPCSPGDPLVLE 1 AS+ CSPGDPLVLE Sbjct: 3 ASNSCSPGDPLVLE 16 >SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = -3 Query: 45 RASDPCSPGDPLVLE 1 R S+ CSPGDPLVLE Sbjct: 23 RLSNSCSPGDPLVLE 37 >SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -3 Query: 42 ASDPCSPGDPLVLE 1 AS+ CSPGDPLVLE Sbjct: 10 ASNSCSPGDPLVLE 23 >SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -3 Query: 42 ASDPCSPGDPLVLE 1 AS+ CSPGDPLVLE Sbjct: 42 ASNSCSPGDPLVLE 55 >SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -3 Query: 42 ASDPCSPGDPLVLE 1 AS+ CSPGDPLVLE Sbjct: 38 ASNSCSPGDPLVLE 51 >SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -3 Query: 42 ASDPCSPGDPLVLE 1 AS+ CSPGDPLVLE Sbjct: 20 ASNSCSPGDPLVLE 33 >SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -3 Query: 42 ASDPCSPGDPLVLE 1 AS+ CSPGDPLVLE Sbjct: 14 ASNSCSPGDPLVLE 27 >SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 29.9 bits (64), Expect = 1.1 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = +3 Query: 3 LELVDPPGCRDRWREEQTALSRWRTRTGPD 92 LELVDPPGCR+ + +R T PD Sbjct: 33 LELVDPPGCRNSMPDRPRHAARPTHDTQPD 62 >SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -3 Query: 42 ASDPCSPGDPLVLE 1 AS+ CSPGDPLVLE Sbjct: 53 ASNSCSPGDPLVLE 66 >SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -3 Query: 42 ASDPCSPGDPLVLE 1 AS+ CSPGDPLVLE Sbjct: 6 ASNSCSPGDPLVLE 19 >SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = -3 Query: 45 RASDPCSPGDPLVLE 1 R S+ CSPGDPLVLE Sbjct: 21 RESNSCSPGDPLVLE 35 >SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1010 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -3 Query: 42 ASDPCSPGDPLVLE 1 AS+ CSPGDPLVLE Sbjct: 83 ASNSCSPGDPLVLE 96 >SB_19076| Best HMM Match : HECT (HMM E-Value=0) Length = 2018 Score = 29.9 bits (64), Expect = 1.1 Identities = 18/43 (41%), Positives = 25/43 (58%), Gaps = 5/43 (11%) Frame = -2 Query: 124 HPVHDPRAKRASGPVRVRQRESAVCSS-----RQRSLQPGGST 11 HP+HDP K AS RVR+ ++A+ S R+R + P ST Sbjct: 1184 HPLHDPHPKTASKDRRVRE-DAAILRSWESKRRRRQVTPSVST 1225 >SB_15961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = -3 Query: 45 RASDPCSPGDPLVLE 1 R S+ CSPGDPLVLE Sbjct: 76 RESNSCSPGDPLVLE 90 >SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 29.9 bits (64), Expect = 1.1 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = -3 Query: 48 LRASDPCSPGDPLVLE 1 ++ S+ CSPGDPLVLE Sbjct: 1 MKVSNSCSPGDPLVLE 16 >SB_8860| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -3 Query: 42 ASDPCSPGDPLVLE 1 AS+ CSPGDPLVLE Sbjct: 32 ASNSCSPGDPLVLE 45 >SB_7929| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -3 Query: 42 ASDPCSPGDPLVLE 1 AS+ CSPGDPLVLE Sbjct: 25 ASNSCSPGDPLVLE 38 >SB_5250| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 29.9 bits (64), Expect = 1.1 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = -3 Query: 48 LRASDPCSPGDPLVLE 1 ++ S+ CSPGDPLVLE Sbjct: 8 IKTSNSCSPGDPLVLE 23 >SB_2869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -3 Query: 42 ASDPCSPGDPLVLE 1 AS+ CSPGDPLVLE Sbjct: 12 ASNSCSPGDPLVLE 25 >SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -3 Query: 48 LRASDPCSPGDPLVLE 1 L S+ CSPGDPLVLE Sbjct: 3 LHVSNSCSPGDPLVLE 18 >SB_56894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = -3 Query: 45 RASDPCSPGDPLVLE 1 R S+ CSPGDPLVLE Sbjct: 5 RRSNSCSPGDPLVLE 19 >SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = -3 Query: 45 RASDPCSPGDPLVLE 1 R S+ CSPGDPLVLE Sbjct: 7 RRSNSCSPGDPLVLE 21 >SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -3 Query: 48 LRASDPCSPGDPLVLE 1 L S+ CSPGDPLVLE Sbjct: 5 LHVSNSCSPGDPLVLE 20 >SB_54339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -3 Query: 42 ASDPCSPGDPLVLE 1 AS+ CSPGDPLVLE Sbjct: 29 ASNSCSPGDPLVLE 42 >SB_53934| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -3 Query: 42 ASDPCSPGDPLVLE 1 AS+ CSPGDPLVLE Sbjct: 20 ASNSCSPGDPLVLE 33 >SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1584 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -3 Query: 42 ASDPCSPGDPLVLE 1 AS+ CSPGDPLVLE Sbjct: 1193 ASNSCSPGDPLVLE 1206 >SB_53415| Best HMM Match : efhand (HMM E-Value=2.7e-12) Length = 923 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/22 (54%), Positives = 16/22 (72%) Frame = -3 Query: 66 VKAQFVLRASDPCSPGDPLVLE 1 ++ V +S+ CSPGDPLVLE Sbjct: 791 LRVMLVAISSNSCSPGDPLVLE 812 >SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -3 Query: 42 ASDPCSPGDPLVLE 1 AS+ CSPGDPLVLE Sbjct: 7 ASNSCSPGDPLVLE 20 >SB_46688| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = -3 Query: 51 VLRASDPCSPGDPLVLE 1 V+ S+ CSPGDPLVLE Sbjct: 2 VIDTSNSCSPGDPLVLE 18 >SB_46641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/22 (54%), Positives = 17/22 (77%) Frame = -3 Query: 66 VKAQFVLRASDPCSPGDPLVLE 1 ++ +F +S+ CSPGDPLVLE Sbjct: 59 MEGRFPKLSSNSCSPGDPLVLE 80 >SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = -3 Query: 45 RASDPCSPGDPLVLE 1 R S+ CSPGDPLVLE Sbjct: 31 RISNSCSPGDPLVLE 45 >SB_45361| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -3 Query: 42 ASDPCSPGDPLVLE 1 AS+ CSPGDPLVLE Sbjct: 2 ASNSCSPGDPLVLE 15 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -3 Query: 42 ASDPCSPGDPLVLE 1 AS+ CSPGDPLVLE Sbjct: 2422 ASNSCSPGDPLVLE 2435 >SB_44586| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 542 Score = 29.9 bits (64), Expect = 1.1 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -3 Query: 57 QFVLRASDPCSPGDPLVLE 1 Q V S+ CSPGDPLVLE Sbjct: 51 QHVRALSNSCSPGDPLVLE 69 >SB_44533| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -3 Query: 48 LRASDPCSPGDPLVLE 1 L+ S+ CSPGDPLVLE Sbjct: 27 LQRSNSCSPGDPLVLE 42 >SB_43349| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -3 Query: 42 ASDPCSPGDPLVLE 1 AS+ CSPGDPLVLE Sbjct: 2 ASNSCSPGDPLVLE 15 >SB_43244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -3 Query: 42 ASDPCSPGDPLVLE 1 AS+ CSPGDPLVLE Sbjct: 5 ASNSCSPGDPLVLE 18 >SB_43046| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -3 Query: 42 ASDPCSPGDPLVLE 1 AS+ CSPGDPLVLE Sbjct: 4 ASNSCSPGDPLVLE 17 >SB_41735| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -3 Query: 42 ASDPCSPGDPLVLE 1 AS+ CSPGDPLVLE Sbjct: 7 ASNSCSPGDPLVLE 20 >SB_40073| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -3 Query: 42 ASDPCSPGDPLVLE 1 AS+ CSPGDPLVLE Sbjct: 47 ASNSCSPGDPLVLE 60 >SB_36996| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = -3 Query: 45 RASDPCSPGDPLVLE 1 R S+ CSPGDPLVLE Sbjct: 2 RKSNSCSPGDPLVLE 16 >SB_36119| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 29.9 bits (64), Expect = 1.1 Identities = 17/40 (42%), Positives = 25/40 (62%) Frame = -3 Query: 120 LYMTRVQKERLDPSEYANVKAQFVLRASDPCSPGDPLVLE 1 +Y+ R+ E L+ S + + V + S+ CSPGDPLVLE Sbjct: 1 MYLCRIISE-LNQSTRGD--SPIVEKRSNSCSPGDPLVLE 37 >SB_36003| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -3 Query: 42 ASDPCSPGDPLVLE 1 AS+ CSPGDPLVLE Sbjct: 26 ASNSCSPGDPLVLE 39 >SB_34253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -3 Query: 48 LRASDPCSPGDPLVLE 1 L +S+ CSPGDPLVLE Sbjct: 12 LSSSNSCSPGDPLVLE 27 >SB_34241| Best HMM Match : RuvA_C (HMM E-Value=1.5) Length = 274 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = -3 Query: 51 VLRASDPCSPGDPLVLE 1 V +S+ CSPGDPLVLE Sbjct: 147 VANSSNSCSPGDPLVLE 163 >SB_33166| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = -3 Query: 45 RASDPCSPGDPLVLE 1 R S+ CSPGDPLVLE Sbjct: 58 RRSNSCSPGDPLVLE 72 >SB_32763| Best HMM Match : Histone_HNS (HMM E-Value=0.15) Length = 481 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -3 Query: 42 ASDPCSPGDPLVLE 1 AS+ CSPGDPLVLE Sbjct: 357 ASNSCSPGDPLVLE 370 >SB_31130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -3 Query: 42 ASDPCSPGDPLVLE 1 AS+ CSPGDPLVLE Sbjct: 8 ASNSCSPGDPLVLE 21 >SB_30823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = -3 Query: 45 RASDPCSPGDPLVLE 1 R S+ CSPGDPLVLE Sbjct: 59 RRSNSCSPGDPLVLE 73 >SB_30669| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -3 Query: 42 ASDPCSPGDPLVLE 1 AS+ CSPGDPLVLE Sbjct: 11 ASNSCSPGDPLVLE 24 >SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 399 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -3 Query: 42 ASDPCSPGDPLVLE 1 AS+ CSPGDPLVLE Sbjct: 21 ASNSCSPGDPLVLE 34 >SB_30190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = -3 Query: 51 VLRASDPCSPGDPLVLE 1 V + S+ CSPGDPLVLE Sbjct: 25 VQKGSNSCSPGDPLVLE 41 >SB_28183| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = -3 Query: 45 RASDPCSPGDPLVLE 1 R S+ CSPGDPLVLE Sbjct: 17 RESNSCSPGDPLVLE 31 >SB_27866| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -3 Query: 42 ASDPCSPGDPLVLE 1 AS+ CSPGDPLVLE Sbjct: 3 ASNSCSPGDPLVLE 16 >SB_26870| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -3 Query: 42 ASDPCSPGDPLVLE 1 AS+ CSPGDPLVLE Sbjct: 2 ASNSCSPGDPLVLE 15 >SB_25764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -3 Query: 42 ASDPCSPGDPLVLE 1 AS+ CSPGDPLVLE Sbjct: 11 ASNSCSPGDPLVLE 24 >SB_23292| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -3 Query: 42 ASDPCSPGDPLVLE 1 AS+ CSPGDPLVLE Sbjct: 3 ASNSCSPGDPLVLE 16 >SB_23203| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -3 Query: 42 ASDPCSPGDPLVLE 1 AS+ CSPGDPLVLE Sbjct: 2 ASNSCSPGDPLVLE 15 >SB_23161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -3 Query: 42 ASDPCSPGDPLVLE 1 AS+ CSPGDPLVLE Sbjct: 10 ASNSCSPGDPLVLE 23 >SB_22083| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = -3 Query: 57 QFVLRASDPCSPGDPLVLE 1 ++ L S+ CSPGDPLVLE Sbjct: 14 EWKLELSNSCSPGDPLVLE 32 >SB_21702| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -3 Query: 48 LRASDPCSPGDPLVLE 1 L S+ CSPGDPLVLE Sbjct: 12 LEVSNSCSPGDPLVLE 27 >SB_17859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -3 Query: 42 ASDPCSPGDPLVLE 1 AS+ CSPGDPLVLE Sbjct: 38 ASNSCSPGDPLVLE 51 >SB_17747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 29.9 bits (64), Expect = 1.1 Identities = 15/30 (50%), Positives = 18/30 (60%) Frame = -3 Query: 90 LDPSEYANVKAQFVLRASDPCSPGDPLVLE 1 L PS + + L S+ CSPGDPLVLE Sbjct: 39 LVPSTSVTLFIENRLMRSNSCSPGDPLVLE 68 >SB_15685| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -3 Query: 42 ASDPCSPGDPLVLE 1 AS+ CSPGDPLVLE Sbjct: 5 ASNSCSPGDPLVLE 18 >SB_15081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -3 Query: 42 ASDPCSPGDPLVLE 1 AS+ CSPGDPLVLE Sbjct: 15 ASNSCSPGDPLVLE 28 >SB_13994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = -3 Query: 45 RASDPCSPGDPLVLE 1 R S+ CSPGDPLVLE Sbjct: 2 RRSNSCSPGDPLVLE 16 >SB_12908| Best HMM Match : Drf_FH1 (HMM E-Value=4.9) Length = 283 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -3 Query: 42 ASDPCSPGDPLVLE 1 AS+ CSPGDPLVLE Sbjct: 159 ASNSCSPGDPLVLE 172 >SB_12674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -3 Query: 42 ASDPCSPGDPLVLE 1 AS+ CSPGDPLVLE Sbjct: 4 ASNSCSPGDPLVLE 17 >SB_10647| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = -3 Query: 45 RASDPCSPGDPLVLE 1 R S+ CSPGDPLVLE Sbjct: 7 RRSNSCSPGDPLVLE 21 >SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) Length = 1101 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -3 Query: 42 ASDPCSPGDPLVLE 1 AS+ CSPGDPLVLE Sbjct: 662 ASNSCSPGDPLVLE 675 >SB_9854| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -3 Query: 42 ASDPCSPGDPLVLE 1 AS+ CSPGDPLVLE Sbjct: 19 ASNSCSPGDPLVLE 32 >SB_9445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -3 Query: 42 ASDPCSPGDPLVLE 1 AS+ CSPGDPLVLE Sbjct: 21 ASNSCSPGDPLVLE 34 >SB_9069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -3 Query: 42 ASDPCSPGDPLVLE 1 AS+ CSPGDPLVLE Sbjct: 8 ASNSCSPGDPLVLE 21 >SB_6535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -3 Query: 42 ASDPCSPGDPLVLE 1 AS+ CSPGDPLVLE Sbjct: 13 ASNSCSPGDPLVLE 26 >SB_4378| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -3 Query: 42 ASDPCSPGDPLVLE 1 AS+ CSPGDPLVLE Sbjct: 33 ASNSCSPGDPLVLE 46 >SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -3 Query: 42 ASDPCSPGDPLVLE 1 AS+ CSPGDPLVLE Sbjct: 5 ASNSCSPGDPLVLE 18 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 29.5 bits (63), Expect = 1.5 Identities = 15/28 (53%), Positives = 17/28 (60%) Frame = -3 Query: 84 PSEYANVKAQFVLRASDPCSPGDPLVLE 1 P N +A V S+ CSPGDPLVLE Sbjct: 14 PLRNPNTRAHLV---SNSCSPGDPLVLE 38 >SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 29.5 bits (63), Expect = 1.5 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -3 Query: 48 LRASDPCSPGDPLVLE 1 L S+ CSPGDPLVLE Sbjct: 10 LERSNSCSPGDPLVLE 25 >SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 29.5 bits (63), Expect = 1.5 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +3 Query: 3 LELVDPPGCRDRWREEQTALSRW 71 LELVDPPGCR+ ++T W Sbjct: 13 LELVDPPGCRNSMLPKRTEGFAW 35 >SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 29.5 bits (63), Expect = 1.5 Identities = 15/44 (34%), Positives = 25/44 (56%) Frame = -3 Query: 132 EVDILYMTRVQKERLDPSEYANVKAQFVLRASDPCSPGDPLVLE 1 E+ + + + + RLD + + + + S+ CSPGDPLVLE Sbjct: 7 EIKVGFTCALPQNRLDLT--FTLGSVIIASLSNSCSPGDPLVLE 48 >SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 29.5 bits (63), Expect = 1.5 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -3 Query: 48 LRASDPCSPGDPLVLE 1 L S+ CSPGDPLVLE Sbjct: 21 LELSNSCSPGDPLVLE 36 >SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 29.5 bits (63), Expect = 1.5 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = -3 Query: 45 RASDPCSPGDPLVLE 1 ++S+ CSPGDPLVLE Sbjct: 6 KSSNSCSPGDPLVLE 20 >SB_21293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 29.5 bits (63), Expect = 1.5 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -3 Query: 48 LRASDPCSPGDPLVLE 1 L S+ CSPGDPLVLE Sbjct: 10 LSTSNSCSPGDPLVLE 25 >SB_20039| Best HMM Match : LRR_1 (HMM E-Value=0.0061) Length = 608 Score = 29.5 bits (63), Expect = 1.5 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -3 Query: 48 LRASDPCSPGDPLVLE 1 L S+ CSPGDPLVLE Sbjct: 3 LTGSNSCSPGDPLVLE 18 >SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 29.5 bits (63), Expect = 1.5 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = -3 Query: 66 VKAQFVLRASDPCSPGDPLVLE 1 + A + S+ CSPGDPLVLE Sbjct: 9 ISANIDIPLSNSCSPGDPLVLE 30 >SB_17987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 29.5 bits (63), Expect = 1.5 Identities = 15/24 (62%), Positives = 17/24 (70%) Frame = -3 Query: 72 ANVKAQFVLRASDPCSPGDPLVLE 1 AN+KA S+ CSPGDPLVLE Sbjct: 11 ANIKA-----GSNSCSPGDPLVLE 29 >SB_13641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 29.5 bits (63), Expect = 1.5 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = -3 Query: 45 RASDPCSPGDPLVLE 1 ++S+ CSPGDPLVLE Sbjct: 4 KSSNSCSPGDPLVLE 18 >SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 29.5 bits (63), Expect = 1.5 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = -3 Query: 48 LRASDPCSPGDPLVLE 1 ++ S+ CSPGDPLVLE Sbjct: 49 IKISNSCSPGDPLVLE 64 >SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 29.5 bits (63), Expect = 1.5 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = -3 Query: 51 VLRASDPCSPGDPLVLE 1 ++ S+ CSPGDPLVLE Sbjct: 13 IVHISNSCSPGDPLVLE 29 >SB_8191| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 29.5 bits (63), Expect = 1.5 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = -3 Query: 51 VLRASDPCSPGDPLVLE 1 V+ S+ CSPGDPLVLE Sbjct: 5 VIFTSNSCSPGDPLVLE 21 >SB_7279| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 29.5 bits (63), Expect = 1.5 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = -3 Query: 48 LRASDPCSPGDPLVLE 1 + +S+ CSPGDPLVLE Sbjct: 13 INSSNSCSPGDPLVLE 28 >SB_753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 29.5 bits (63), Expect = 1.5 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = -3 Query: 51 VLRASDPCSPGDPLVLE 1 +L S+ CSPGDPLVLE Sbjct: 1 MLSLSNSCSPGDPLVLE 17 >SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 276 Score = 29.5 bits (63), Expect = 1.5 Identities = 18/39 (46%), Positives = 23/39 (58%), Gaps = 2/39 (5%) Frame = -3 Query: 111 TRVQKER-LDPSEYANVKAQFVL-RASDPCSPGDPLVLE 1 +R+QK L PS + L + S+ CSPGDPLVLE Sbjct: 127 SRLQKMHYLSPSTWFPYSRNSRLEKISNSCSPGDPLVLE 165 >SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 29.5 bits (63), Expect = 1.5 Identities = 17/39 (43%), Positives = 24/39 (61%) Frame = -3 Query: 117 YMTRVQKERLDPSEYANVKAQFVLRASDPCSPGDPLVLE 1 + + +QK++L S K F + S+ CSPGDPLVLE Sbjct: 29 WYSHIQKKKLKAS-----KKNFFI--SNSCSPGDPLVLE 60 >SB_55000| Best HMM Match : DUF765 (HMM E-Value=3.9) Length = 147 Score = 29.5 bits (63), Expect = 1.5 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -3 Query: 48 LRASDPCSPGDPLVLE 1 L S+ CSPGDPLVLE Sbjct: 21 LTTSNSCSPGDPLVLE 36 >SB_52165| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 29.5 bits (63), Expect = 1.5 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = -3 Query: 63 KAQFVLRASDPCSPGDPLVLE 1 KA + S+ CSPGDPLVLE Sbjct: 13 KASGLHSGSNSCSPGDPLVLE 33 >SB_50670| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 29.5 bits (63), Expect = 1.5 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = -3 Query: 51 VLRASDPCSPGDPLVLE 1 +L S+ CSPGDPLVLE Sbjct: 3 ILFLSNSCSPGDPLVLE 19 >SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 29.5 bits (63), Expect = 1.5 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = -3 Query: 51 VLRASDPCSPGDPLVLE 1 +L S+ CSPGDPLVLE Sbjct: 1 MLYVSNSCSPGDPLVLE 17 >SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 29.5 bits (63), Expect = 1.5 Identities = 14/25 (56%), Positives = 17/25 (68%) Frame = -3 Query: 75 YANVKAQFVLRASDPCSPGDPLVLE 1 Y N+ +R S+ CSPGDPLVLE Sbjct: 44 YPNLTIDLHVR-SNSCSPGDPLVLE 67 >SB_44783| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 29.5 bits (63), Expect = 1.5 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -3 Query: 48 LRASDPCSPGDPLVLE 1 L S+ CSPGDPLVLE Sbjct: 5 LEPSNSCSPGDPLVLE 20 >SB_39773| Best HMM Match : DUF765 (HMM E-Value=4.1) Length = 126 Score = 29.5 bits (63), Expect = 1.5 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = -3 Query: 48 LRASDPCSPGDPLVLE 1 + +S+ CSPGDPLVLE Sbjct: 1 MHSSNSCSPGDPLVLE 16 >SB_38949| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 29.5 bits (63), Expect = 1.5 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -3 Query: 48 LRASDPCSPGDPLVLE 1 L S+ CSPGDPLVLE Sbjct: 14 LTGSNSCSPGDPLVLE 29 >SB_31086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 29.5 bits (63), Expect = 1.5 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = -3 Query: 72 ANVKAQFVLRASDPCSPGDPLVLE 1 A +K + S+ CSPGDPLVLE Sbjct: 15 AKIKLFNIGHRSNSCSPGDPLVLE 38 >SB_30732| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 29.5 bits (63), Expect = 1.5 Identities = 16/26 (61%), Positives = 18/26 (69%), Gaps = 2/26 (7%) Frame = -3 Query: 72 ANVKAQFVLRA--SDPCSPGDPLVLE 1 A VKA + A S+ CSPGDPLVLE Sbjct: 60 ARVKAANFVTATESNSCSPGDPLVLE 85 >SB_27816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 29.5 bits (63), Expect = 1.5 Identities = 17/51 (33%), Positives = 24/51 (47%) Frame = -3 Query: 153 YLEEVMAEVDILYMTRVQKERLDPSEYANVKAQFVLRASDPCSPGDPLVLE 1 YL + V + T V +P + + + S+ CSPGDPLVLE Sbjct: 55 YLHTFIRSVQAVSGTAVSGVDFEPLQ-TTINIPPSVSTSNSCSPGDPLVLE 104 >SB_18776| Best HMM Match : DUF765 (HMM E-Value=4) Length = 134 Score = 29.5 bits (63), Expect = 1.5 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = -3 Query: 51 VLRASDPCSPGDPLVLE 1 + + S+ CSPGDPLVLE Sbjct: 7 ISKTSNSCSPGDPLVLE 23 >SB_15671| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 139 Score = 29.5 bits (63), Expect = 1.5 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = -3 Query: 51 VLRASDPCSPGDPLVLE 1 V +S+ CSPGDPLVLE Sbjct: 12 VTASSNSCSPGDPLVLE 28 >SB_14727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 29.5 bits (63), Expect = 1.5 Identities = 17/46 (36%), Positives = 24/46 (52%) Frame = -3 Query: 138 MAEVDILYMTRVQKERLDPSEYANVKAQFVLRASDPCSPGDPLVLE 1 MA + +L + +E L+ + A S+ CSPGDPLVLE Sbjct: 22 MAGLAVLSKVKATEECLEQKQNAIRACTDKPFRSNSCSPGDPLVLE 67 >SB_8232| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 192 Score = 29.5 bits (63), Expect = 1.5 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = -3 Query: 48 LRASDPCSPGDPLVLE 1 ++ S+ CSPGDPLVLE Sbjct: 66 IKISNSCSPGDPLVLE 81 >SB_7555| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 29.5 bits (63), Expect = 1.5 Identities = 14/25 (56%), Positives = 17/25 (68%) Frame = -3 Query: 75 YANVKAQFVLRASDPCSPGDPLVLE 1 Y N + +V S+ CSPGDPLVLE Sbjct: 42 YENKRRVYV--TSNSCSPGDPLVLE 64 >SB_6419| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 29.5 bits (63), Expect = 1.5 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = -3 Query: 51 VLRASDPCSPGDPLVLE 1 V S+ CSPGDPLVLE Sbjct: 47 VTHTSNSCSPGDPLVLE 63 >SB_4657| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 29.5 bits (63), Expect = 1.5 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = -3 Query: 51 VLRASDPCSPGDPLVLE 1 V+ S+ CSPGDPLVLE Sbjct: 43 VIGISNSCSPGDPLVLE 59 >SB_2671| Best HMM Match : Amidohydro_2 (HMM E-Value=5.6) Length = 270 Score = 29.5 bits (63), Expect = 1.5 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = -3 Query: 75 YANVKAQFVLRASDPCSPGDPLVLE 1 + N+ L S+ CSPGDPLVLE Sbjct: 135 HCNLLFSINLITSNSCSPGDPLVLE 159 >SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 29.1 bits (62), Expect = 1.9 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -3 Query: 45 RASDPCSPGDPLVLE 1 + S+ CSPGDPLVLE Sbjct: 9 KTSNSCSPGDPLVLE 23 >SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 29.1 bits (62), Expect = 1.9 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = -3 Query: 54 FVLRASDPCSPGDPLVLE 1 F+ S+ CSPGDPLVLE Sbjct: 6 FMHTRSNSCSPGDPLVLE 23 >SB_49546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1214 Score = 29.1 bits (62), Expect = 1.9 Identities = 14/41 (34%), Positives = 20/41 (48%) Frame = -2 Query: 130 SRHPVHDPRAKRASGPVRVRQRESAVCSSRQRSLQPGGSTS 8 SR P H+PR+KR+ +QR S S + S+S Sbjct: 1166 SRSPNHEPRSKRSKANPSAQQRASPTTSDEEPETSQKASSS 1206 >SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 29.1 bits (62), Expect = 1.9 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -3 Query: 48 LRASDPCSPGDPLVLE 1 L S+ CSPGDPLVLE Sbjct: 2 LARSNSCSPGDPLVLE 17 >SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 29.1 bits (62), Expect = 1.9 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = -3 Query: 51 VLRASDPCSPGDPLVLE 1 V+ S+ CSPGDPLVLE Sbjct: 44 VVVTSNSCSPGDPLVLE 60 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,312,578 Number of Sequences: 59808 Number of extensions: 257212 Number of successful extensions: 2857 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 2818 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2856 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 969807871 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -