BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1053 (634 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_UPI00004BB047 Cluster: UPI00004BB047 related cluster; n... 33 5.7 >UniRef50_UPI00004BB047 Cluster: UPI00004BB047 related cluster; n=1; Canis lupus familiaris|Rep: UPI00004BB047 UniRef100 entry - Canis familiaris Length = 271 Score = 33.1 bits (72), Expect = 5.7 Identities = 20/59 (33%), Positives = 29/59 (49%), Gaps = 3/59 (5%) Frame = +2 Query: 317 WQTPTWAYNAAYDHFVIKQTFFMF--VFYYSTLPHRTCQL*ASISLEKLVPAS-WTWPP 484 W +P WA+NAA V+ + V+ + +PH T A L L PAS ++W P Sbjct: 158 WTSPAWAFNAAVALAVLVAAGLVVSGVYIFFLIPHATSSGPARPQLVALAPASGFSWFP 216 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 659,195,746 Number of Sequences: 1657284 Number of extensions: 12764390 Number of successful extensions: 24982 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 23776 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24975 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 46881492319 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -