BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1050 (593 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_41834| Best HMM Match : Glyco_hydro_20 (HMM E-Value=0) 31 0.93 SB_14034| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 >SB_41834| Best HMM Match : Glyco_hydro_20 (HMM E-Value=0) Length = 296 Score = 30.7 bits (66), Expect = 0.93 Identities = 13/28 (46%), Positives = 21/28 (75%) Frame = +1 Query: 409 NLKTFHIIRMYFWVRLERILSASGQLIV 492 NLKT H ++ YF ++LE+ILS G+ ++ Sbjct: 147 NLKTNHDLQTYFNIKLEKILSKFGKKLM 174 >SB_14034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 27.5 bits (58), Expect = 8.6 Identities = 18/71 (25%), Positives = 33/71 (46%), Gaps = 2/71 (2%) Frame = +3 Query: 72 ICYQNV--HKLNYNYMLLKIFLNISL*KYRYSFFLNYILHYSCSQNAQL*FLWLIIICPI 245 IC Q+ YNY+LL + Y+Y++ L + + + Q + +L++IC Sbjct: 15 ICVQSTAASSYQYNYLLLICVQGTAASFYQYNYLLMIFVQSTAASFYQ--YNYLLLICVQ 72 Query: 246 VQQSDPIEYNY 278 + +YNY Sbjct: 73 STAASFYQYNY 83 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,216,251 Number of Sequences: 59808 Number of extensions: 241387 Number of successful extensions: 553 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 520 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 553 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1427401750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -