BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1050 (593 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. 25 0.42 AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly pro... 25 0.42 AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly pro... 25 0.42 AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly pro... 25 0.74 Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP... 22 3.9 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 22 3.9 X16709-1|CAA34681.1| 162|Apis mellifera phospholipase A-2 protein. 22 5.2 EF373554-1|ABQ28728.1| 167|Apis mellifera phospholipase A2 prot... 22 5.2 AF438408-1|AAL30844.1| 167|Apis mellifera phospholipase A2 prot... 22 5.2 DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex det... 21 6.9 AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 21 6.9 >D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. Length = 432 Score = 25.4 bits (53), Expect = 0.42 Identities = 14/39 (35%), Positives = 22/39 (56%), Gaps = 2/39 (5%) Frame = +1 Query: 463 ILSASGQLIVST*FNF--FCFVYQGLNINDLIINSTIQN 573 +LS Q +V+ FNF F N+N+LI+N+ +N Sbjct: 380 VLSNKMQKMVNNDFNFDDVNFRIMNANVNELILNTRCEN 418 >AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 25.4 bits (53), Expect = 0.42 Identities = 14/39 (35%), Positives = 22/39 (56%), Gaps = 2/39 (5%) Frame = +1 Query: 463 ILSASGQLIVST*FNF--FCFVYQGLNINDLIINSTIQN 573 +LS Q +V+ FNF F N+N+LI+N+ +N Sbjct: 380 VLSNKMQKMVNNDFNFDDVNFRIMNANVNELILNTRCEN 418 >AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 25.4 bits (53), Expect = 0.42 Identities = 14/39 (35%), Positives = 22/39 (56%), Gaps = 2/39 (5%) Frame = +1 Query: 463 ILSASGQLIVST*FNF--FCFVYQGLNINDLIINSTIQN 573 +LS Q +V+ FNF F N+N+LI+N+ +N Sbjct: 380 VLSNKMQKMVNNDFNFDDVNFRIMNANVNELILNTRCEN 418 >AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly protein MRJP5 protein. Length = 598 Score = 24.6 bits (51), Expect = 0.74 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +1 Query: 502 FNFFCFVYQGLNINDLIINSTIQNN 576 FN F G N+NDLI+N+ N+ Sbjct: 562 FNEVNFRILGANVNDLIMNTRCANS 586 >Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP57-2 protein. Length = 464 Score = 22.2 bits (45), Expect = 3.9 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +1 Query: 517 FVYQGLNINDLIINSTIQN 573 F G N+NDLI NS N Sbjct: 398 FQILGANVNDLIRNSRCAN 416 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 22.2 bits (45), Expect = 3.9 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = +3 Query: 24 HSDVTECIFC 53 H DVT+CI C Sbjct: 620 HKDVTQCISC 629 >X16709-1|CAA34681.1| 162|Apis mellifera phospholipase A-2 protein. Length = 162 Score = 21.8 bits (44), Expect = 5.2 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +1 Query: 73 YVIKMYTNLTITTCY 117 +V KMY NL T CY Sbjct: 110 FVGKMYFNLIDTKCY 124 >EF373554-1|ABQ28728.1| 167|Apis mellifera phospholipase A2 protein. Length = 167 Score = 21.8 bits (44), Expect = 5.2 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +1 Query: 73 YVIKMYTNLTITTCY 117 +V KMY NL T CY Sbjct: 115 FVGKMYFNLIDTKCY 129 >AF438408-1|AAL30844.1| 167|Apis mellifera phospholipase A2 protein. Length = 167 Score = 21.8 bits (44), Expect = 5.2 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +1 Query: 73 YVIKMYTNLTITTCY 117 +V KMY NL T CY Sbjct: 115 FVGKMYFNLIDTKCY 129 >DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 21.4 bits (43), Expect = 6.9 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -3 Query: 213 KVVHFDYNYSVEYNLKKN 160 K +H + NY YN K N Sbjct: 88 KTIHNNNNYKYNYNNKYN 105 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 21.4 bits (43), Expect = 6.9 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = +3 Query: 60 IIYSICYQNVHKLNYNYMLLKIFLNI 137 II S+ +H NYN L +NI Sbjct: 314 IISSLSNNTIHNNNYNKKLYYNIINI 339 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 145,724 Number of Sequences: 438 Number of extensions: 3185 Number of successful extensions: 12 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17359926 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -