BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1049 (659 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U97015-6|AAB52345.2| 1064|Caenorhabditis elegans Hypothetical pr... 29 2.9 >U97015-6|AAB52345.2| 1064|Caenorhabditis elegans Hypothetical protein F48C1.1 protein. Length = 1064 Score = 29.1 bits (62), Expect = 2.9 Identities = 18/72 (25%), Positives = 37/72 (51%), Gaps = 1/72 (1%) Frame = +1 Query: 16 QNESASQQPVY-LVRSYVRHLLSYFASLNLTFFVVLTEYTYSFIYNLIKHH*RASVKKFL 192 +N A Q ++ L S R +L ++++ FF +L + ++ L +H+ + + + Sbjct: 10 KNSKAIIQKMHRLALSAKRKVLLNPKTVSIYFFAILFTFLLAYHQRLGQHNNELHISRVV 69 Query: 193 NLRSLFKFSENL 228 N+RS K + NL Sbjct: 70 NMRSFVKEANNL 81 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,175,878 Number of Sequences: 27780 Number of extensions: 221457 Number of successful extensions: 529 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 524 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 529 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1476380920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -